KEGG   Dinoponera quadriceps: 106744711Help
Entry
106744711         CDS       T05610                                 

Definition
(RefSeq) DNA repair protein complementing XP-G cells isoform X1
  KO
K10846  DNA excision repair protein ERCC-5
Organism
dqu  Dinoponera quadriceps
Pathway
dqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    106744711
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dqu03400]
    106744711
DNA repair and recombination proteins [BR:dqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     106744711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 106744711
NCBI-ProteinID: XP_014475169
LinkDB All DBs
Position
Unknown
AA seq 1137 aa AA seqDB search
MGVYGLWRLLDASGKPVVLESLEGKVLAIDISIWIYQMLQGYQNQHGTTKPNAHLLGLFI
RICKLLYYRIKPVFVFDGGVPMLKKNTIASRRKQKSIATNKAQKMKADLISNLIKHTMAK
TVLNQDPKADPDNGAMQMTINLLTKRPEEDMFALPDMSSNGDTQTHVIDDDEYDSDVSVE
LSPRKQSKWMGNIHNVDVATNEFKALPADVRYDILTDLRETRKQNSWGRLHEMPEVRESQ
EFSGFQMRRLLKRRYVQQSLETAEKEMGGKTLTLEELDKLLTEQGIDTKGRDAAFRIAAD
DTTRLIYISDKNALNSAESSVGNEAETGENESSRDKSGEVEPVAGPSNPTPIVENMNEYE
LNDDSDNDVVSIHDDPVPIAEDVNEYAFDSDWESAANESRPVDKKYFGKNTRNPALTYML
EYSGLSQDQIIHLISHNNNESCKTAGKKASEKDIRSESAESGDPMGDKLTSLEAIENRED
VSKAVKLRNMQDTQGCLAREDPLTVESIPSSSECDNSIEVEPLENNAETSEFTAKSRAAN
SSNEIIPEERSVAKLDDVTQADTSDSGSDDFIEIHDVPIPDVSRTSTRNENLEITIKSGD
KLEDDLFADVFGKMARSQAVSTSYAKHVKSVDVNDEHRAVSVPEDGNNVKKLDTISEEPT
EEAEKTDIASSENVQSTENASNDDGKVNDSLSPDKPTEQNNTNSEVDFSKESEQKKPVML
PISEEGWIKLKDQLEDEQEELTKSIGKLERQATNISEQVQIEAQELLRLFGIPYVVAPME
AEAQCAYLEQSKLTNGTITDDSDIWLFGGQCVYKNFFNNSKRVQQFCACDIQHHFKLTRN
QLIQLALLVGSDYTTGVAGIGPVTALEILAAFPTEGDNVLHGLHNFYSWMKNGRIATSGK
AGLRNKLRNVKLDRDFPNQAVVQAYLFPTVDESKETFTWGKPNVMLLCDYVRRKFGWTKG
KFDDTIIPVLRRMEEKKSQKILDLYFKTMVSPKLIESNLSKRVQKAVHRLNNKDDGEGED
ANGETRVKKRKKSNAGQRSEKEEKTIESDVPTCTKPKALVGSNDVLDDAIAVSVVHDRTA
DEYIPQRERDKANAFEKKLRAIEIFRKSKQGLARTKKVRRIVRKVKKEVELSESDSN
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgtacggcttgtggcggttgctggacgcatccggcaaaccggtggtcttggag
agcctcgagggcaaagttctggcgatcgacatatcgatatggatataccagatgttgcaa
ggataccagaatcaacacggcactaccaagcctaacgctcatctgctcggtctgtttatc
aggatatgcaagcttttgtactacaggatcaagcctgtcttcgtcttcgatggcggcgtg
ccgatgctcaagaagaatacaattgcctcacgcagaaagcagaagtccatcgccacaaac
aaggcgcagaagatgaaggcagacttgataagcaacttaataaagcacaccatggcgaag
accgttcttaatcaggatcctaaggcggatccggataatggagcgatgcaaatgacgata
aatttgctgactaaacgcccagaggaagatatgttcgctctgcccgatatgtccagcaac
ggtgacacgcagactcacgtaatcgatgacgacgagtacgattctgacgtgtctgtcgag
ctgagtccgcggaagcagtccaagtggatgggaaacatacacaatgttgacgtagccacc
aacgaattcaaagcgttacccgcggacgtccgttacgacatactgaccgacctgcgggag
acgaggaagcaaaattcctggggccgtttacacgagatgcccgaagtacgtgaatcacag
gagttctcaggctttcagatgagacgtctgctgaaacgcagatacgtgcaacagtccttg
gagaccgccgagaaggaaatgggcggcaagacgctgacgctggaggagctggataaattg
ctgaccgaacaaggaatcgacacgaaaggcagagacgcggcgttccgaattgccgcggat
gacacgactcgattaatctacatcagtgacaagaacgcattaaactccgcggaaagttct
gttggtaacgaagcggaaacgggcgaaaacgaatcgtcgcgggacaaaagcggggaagtt
gagccagtcgccggtccaagcaatcctacaccaatcgtggaaaacatgaacgaatatgag
ctgaatgatgactccgacaacgacgtcgtgtcaatccacgacgatcctgtgcctattgca
gaagatgtgaatgaatacgcgtttgacagcgattgggagtctgctgcgaatgagtcacgg
cctgtggataaaaagtactttggcaaaaatacaaggaatcccgcattaacgtacatgttg
gagtacagcggcttgagccaggatcaaataatacatctcatcagtcacaataataacgag
agctgtaagactgcaggcaagaaagcgtccgagaaggatattcgctcggaatctgcggaa
agtggggatccaatgggcgataaattgacgtcacttgaagctatcgaaaatcgcgaggac
gtttcgaaagctgtgaaattgcggaacatgcaagacacgcaaggatgcttggccagagag
gatccgttgactgtcgagtcaattccgtccagttcagagtgtgataattccatcgaagtt
gagcctcttgaaaataacgctgagacatcagaattcaccgcgaaatctcgcgccgcgaat
tcaagtaatgaaataatacccgaggagcgctccgtcgcaaagctcgacgatgtgacgcaa
gcggacacgtcggactcgggctccgatgatttcattgagatccacgatgtcccgataccc
gacgtctcgaggacgtccacgaggaatgaaaatctcgaaataactatcaaatccggcgac
aagctggaggacgacttgtttgccgatgtattcgggaaaatggctcgaagccaagctgtg
tcgacgagttacgcaaagcatgtcaaatccgttgatgtgaacgacgaacaccgggcggta
tcagttcctgaagacggtaataatgtaaaaaaactggacactatatctgaagaaccgacg
gaggaagcggaaaaaacagatatcgcatcgtcagaaaatgttcagtcgactgagaatgca
tcaaatgacgacggcaaagtaaacgattctctaagccctgacaaaccaacggagcaaaat
aatacgaatagtgaagttgatttttccaaggaatctgaacaaaaaaagccagtaatgtta
cctataagtgaggaaggttggataaaactaaaggaccaattggaggacgagcaggaggaa
ctcacaaagagcatcggcaagctcgagagacaagctaccaatatttcggagcaagtccaa
attgaggcgcaggaattgttacgtttatttggcataccctatgtagtggctcctatggaa
gcagaagcgcagtgcgcctatctagagcaaagtaagttaaccaacggcacaattacagac
gactccgacatctggctgttcgggggccaatgtgtgtacaagaattttttcaacaatagc
aagagagtgcagcaattctgtgcctgtgatatccagcatcattttaaacttacccgtaat
cagctgatacaattagccctactggtcggcagcgattacaccacaggggtggctggcatc
ggacctgtcactgcgctggaaatattagccgcctttcccaccgaaggggacaacgtgctg
cacggtttacataatttctactcatggatgaagaacggaagaattgcgacttctgggaag
gcaggcttgcgcaataaactgcgaaatgtgaaattggacagagatttcccgaatcaagcg
gtcgttcaagcgtatctcttccccacggtcgacgagtcgaaagaaactttcacctggggc
aagccgaacgtgatgcttctttgcgactacgtcaggcggaagttcggatggaccaaaggc
aagttcgacgacacgataataccagtgctgaggagaatggaggagaaaaagagccagaag
atcttggatttgtatttcaagacaatggtatccccgaaactcatcgagtcgaacctgagt
aaacgagtacagaaagctgtgcacagattgaataacaaggacgacggggaaggagaagat
gcaaacggcgagacgcgagttaaaaagagaaagaaaagtaatgccggtcagaggtcggag
aaggaagagaagacgatcgagtccgatgtaccaacttgtaccaagcctaaggcactcgtc
ggatcaaacgatgttctcgatgatgcgattgccgtatccgttgttcacgatcgaaccgcc
gatgaatacataccgcaacgggagagggataaggcgaacgcattcgagaagaaattgcgt
gccatagaaatatttaggaaatcgaaacaaggcttggccagaacgaagaaagtgagacgc
attgtacggaaagtcaagaaagaggtggaattatcggaaagcgacagcaattag

DBGET integrated database retrieval system