KEGG   Dinoponera quadriceps: 106745381Help
Entry
106745381         CDS       T05610                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00480  Glutathione metabolism
dqu00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106745381
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    106745381
Enzymes [BR:dqu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     106745381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 106745381
NCBI-ProteinID: XP_014476428
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MNTKHLSTGSVPPPLVPGKIRMYSMRFCPYAQRVLLVLDAKRIPYDVVNVNLKHKPDWLI
EKNPLENIPCIELEGGETLYQSLIIVDYLDEAYPQNKLYPSQPLAKAKDKLLIDRFNEVI
TIMYKLYQTPMLEQELFNEALAGLELYERELAKRGTAFFGGSKPGMLDFMIWPWCERADA
MRILQGEQFVIPRDRFLRLLEWRAAMKEDSVVCGSFLEPEIHAKYMRSRLAGVPQYDLIA
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgaaacacttgagcaccggatcggtacctccgccacttgtacctgggaaaata
cgtatgtacagcatgcgtttctgtccttacgcacaaagggtacttctcgtattggacgca
aaacgaataccgtacgatgtagtaaatgtaaatttgaagcacaagccggactggttgatc
gagaaaaatccactggaaaatataccgtgcatcgagttggagggaggagagacgctttat
cagagcctaatcattgtcgattacttagatgaggcctatcctcaaaataaactgtatcca
agccagcctctggcgaaagccaaagataagttactgattgacagatttaatgaggtgata
acaataatgtacaagttatatcaaacaccaatgctggagcaagagctgttcaatgaggca
ctggctggcttagagctctacgagcgggagttagctaagagaggaacagcttttttcggt
gggagcaagcctggaatgttggattttatgatatggccatggtgtgagagggccgacgca
atgagaattctacagggggaacagtttgtcatacctcgagaccgtttcctgcgactgctc
gaatggagagccgctatgaaggaagattccgtggtgtgtggcagcttcctggaacctgag
atacacgcaaagtacatgcgcagtcgcctagctggtgtaccacagtacgacctgatagct
aacaattaa

DBGET integrated database retrieval system