KEGG   Dinoponera quadriceps: 106746821Help
Entry
106746821         CDS       T05610                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00040  Pentose and glucuronate interconversions
dqu00051  Fructose and mannose metabolism
dqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    106746821
   00051 Fructose and mannose metabolism
    106746821
Enzymes [BR:dqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     106746821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_16 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 106746821
NCBI-ProteinID: XP_014479371
LinkDB All DBs
Position
Unknown
AA seq 407 aa AA seqDB search
MLYITVVPCIYSSEFFLKQECGAASVYHNIGKRGSRLGDAVGRTQPHSDLNFRSRGVMAK
DNLTAVLYGINDLRLENTPIEEPQDGEVLLEMACVGICGSDVHYLVNGRICDFVVREPMI
IGHESAGIVAKLGKNVKNLKVGDRVAIEPGVCCRVCKFCKTGRYNLCKDMMFCATPPVHG
SLRRFYKHAADFCFKLPDHVSLEEGALLEPLSVGVHACKRGSVGIDCKVLILGAGPIGLV
TLLVAKAMGASKVVITDILESRLKIAKKLGADDTYLVQKNRSESDTMADIHAIFGDEPDR
TIDASGAQSSIRLAILVTKSGGVVVLVGMGAREVQVPLINALVREVDIRGVFRYVNDYSD
ALDLIASGKIDVKPLITHNYKMEDTMKAFETSRTGADGAIKVMIHCK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgctatatataaccgtggttccgtgtatatatagcagcgagttcttccttaagcaagag
tgcggtgccgccagtgtttatcataatattgggaagcgtggatctcgactgggagacgcc
gtaggaaggacacagccgcattccgacctgaattttcgaagccgaggagtcatggccaag
gataatctcaccgctgtactttacgggatcaacgatttacgtctggagaacacgcctatc
gaggaaccgcaggacggtgaagtacttctggagatggcatgcgtaggaatctgtgggtcg
gatgttcattatctcgtgaacgggagaatctgcgacttcgtggtgcgcgagcccatgatc
atcggacacgaatctgccggtatcgtcgccaaactcgggaaaaatgtgaaaaacttaaaa
gtcggcgatcgcgtcgccatcgagcctggcgtgtgttgccgggtatgcaagttttgcaag
acaggacgttacaatctgtgtaaggacatgatgttttgcgcgacgccgccggtgcacggc
agcctgagacgtttttacaaacacgcggctgacttctgtttcaaattacccgaccacgtg
agcttagaagaaggagcgctcttagaaccgttatcagtgggagtacacgcttgtaaacga
ggatcagtcggaatcgattgtaaagtattaattctgggggctggtccgatcggtctggtg
acgttattggtggccaaagccatgggtgcgagcaaagtggttattactgatatcttagag
agtagactgaaaatagcgaagaaactcggcgccgacgatacatatctggtacaaaagaat
agatcggagtcggatacaatggctgatattcacgcaatttttggagatgaacctgataga
acgatagacgcttcgggcgcacagtcttcaatacgtttggcaattctcgtgaccaaatct
ggtggagtcgtagtactggtgggcatgggtgctcgtgaggtgcaagttccattaattaac
gcattggtcagagaagtcgacatcaggggtgtcttccgatacgtgaatgactacagcgac
gcgttggatctcattgcatctggtaagatagatgtgaagcctttgatcacccataactac
aagatggaggacactatgaaagcattcgaaaccagcagaactggagcagatggagctatt
aaagtcatgattcactgtaaataa

DBGET integrated database retrieval system