KEGG   Dinoponera quadriceps: 106747058Help
Entry
106747058         CDS       T05610                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106747058
Enzymes [BR:dqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     106747058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 FAD_binding_2 EF-hand_1 EF-hand_6 FAD_oxidored EF-hand_8 GIDA EF-hand_9 Pyr_redox_2 FAD_binding_3 NAD_binding_8 EF-hand_5 HI0933_like Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 106747058
NCBI-ProteinID: XP_014479790
LinkDB All DBs
Position
Unknown
AA seq 719 aa AA seqDB search
MASLKWLVAGASAVGAGTLTSYFLLSDSTVYAEKIKPRPPRRTLPTREDQLKTLKSQDYD
VLIVGGGATGAGCALDACTRGLKTALIEADDFASGTSSRSTKLIHGGVRYLQKAIMQLDV
EQYRMVKEALHERASMLQSAPHLAHPLPIMLPVYTWWQIPYYWFGIKMYDLVAGSKTVKS
SYYLSKSNALELFPMLKGDKLTGAIVYYDGQQDDARMNLAVALTASRHGATVVNHVKVVN
LLKGLDKDGKRVLVGAHLKDELTGEEWDVRAKAIINATGPFTDHIRKMDDQNVPEICSPS
SGVHIVLPGYYSPDQMGLLDPATSDGRVIFFLPWQRQTIAGTTDLPCEVTHNPRPTEDEI
MFILQEVKNYLNPDVEVRRGDVLSAWSGIRPLVSDPNKPNTQSLARNHIVHVSPTNLVTI
AGGKWTTYRAMAQETIDAAIKACELEPERPCQTDGFLLEGAQGWSPTMYIRLVQDFGLEC
EVAQHLSKSYGDRAFAVAKLASLTGKRWPIIGKKIHPEFPYIDAEIRYGVREYARTAIDM
IARRLRLAFLNVQAAQEALPAIIDIMAEELHWSAEEKKKQHREATEFLANEMGQMVNRAS
RDKIPINLTKDEVQLYIKRFGIIDKDKKGYVSINDIRRGLKLFGDKEVPGEELHEILREI
DTNMNGQVELDEYLQMMSAIKSGHVAYSRFARMAEMEEAQHEKEKLKIQISVERSGGGL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgctcaaatggctcgtagcgggagccagtgctgtgggtgccggcactcttact
tcttattttcttctgtcggattccacggtatacgccgaaaagataaaaccaaggccacct
aggaggaccttgccgacgcgggaggatcagttgaagacgctaaaatcacaggactacgat
gttctgatcgtcggaggtggtgcaacgggagcgggatgcgctctggacgcttgcacgcga
ggtttgaagaccgcactgatcgaggccgacgatttcgcctcaggcacctcttcgcgcagc
acaaagttgattcatggcggcgtgcggtatttgcagaaggcgattatgcagttggacgtt
gaacagtacagaatggtgaaggaagcgcttcatgagcgtgcgtcgatgctgcaaagcgcg
ccgcacctggcgcacccattgcccattatgctgccggtttatacgtggtggcagattcct
tactattggttcggtattaagatgtacgatctagtagcgggcagtaaaacggtgaaatct
tcgtattatttgagtaaatcgaatgctttggaactcttcccgatgttgaaaggcgacaag
ctgacgggggctattgtttattacgatggtcaacaagacgacgctaggatgaacttggca
gtcgccctgacagcctcgagacacggtgcgacagtcgtgaatcacgttaaagtggtcaac
ctgttgaaaggccttgacaaggacggcaagcgagtccttgtgggggctcatctgaaggac
gagctcactggagaggaatgggacgtgagggctaaggcgattatcaacgcgactggtccc
ttcaccgatcacatcagaaagatggacgatcagaacgttcctgaaatttgctccccgtcc
tcgggggttcatatagtattgccgggatattacagccccgatcaaatgggtctactcgat
ccagcgacgagcgacggcagagtgatcttctttttgccatggcagaggcaaaccattgca
ggaacgaccgacttgccatgcgaggtaacgcacaatccacgacctacggaggacgagatc
atgttcattctgcaggaggtaaagaactatttgaatccggacgtcgaggtacgccgcggt
gacgttctctcggcatggagcggcatcaggccgctcgtctccgacccgaacaaaccgaac
acgcaatccctcgccaggaatcacatcgtgcatgtcagtcccacaaatctcgtcacgata
gccggtggcaaatggacgacttaccgggcgatggctcaagagactatcgacgcggctata
aaagcttgcgagctcgagccagaaagaccttgtcaaaccgatggcttccttctggagggt
gcccaaggctggagccctacgatgtacattagattggtgcaagacttcggtctggaatgc
gaagtcgcgcaacacttgtccaagagctacggggatcgcgcgttcgctgtggcgaaactg
gcttccctcacggggaagcgatggccgatcatcgggaagaaaattcaccccgaattcccg
tacatcgatgctgagatacgttacggcgtgcgggagtacgccaggaccgcaatcgatatg
attgcgcgccggctgagactcgctttcctcaacgttcaagcggcccaagaggcattaccg
gctattatagacatcatggccgaggaattgcactggtcggcggaggagaagaaaaagcag
catcgcgaggccacggaattcctcgccaacgagatgggtcaaatggtgaatcgtgcttcc
cgcgataaaatccccatcaatctcacgaaggatgaggtccagctttacatcaaacgcttc
ggaatcatagataaggacaaaaaaggatacgtctctatcaacgacattaggcgaggcctg
aagttgttcggagacaaggaagtaccgggcgaggaacttcacgaaattctacgcgaaatc
gacaccaatatgaacggtcaagtcgaattggacgaataccttcagatgatgtcagctata
aaatctggtcacgtggcatactcacgtttcgcgcgaatggccgaaatggaagaggcacag
cacgagaaggagaagcttaaaatacagataagtgtcgagagatcgggcggcggactataa

DBGET integrated database retrieval system