KEGG   Dinoponera quadriceps: 106747102Help
Entry
106747102         CDS       T05610                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu03030  DNA replication
dqu03410  Base excision repair
dqu03420  Nucleotide excision repair
dqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106747102
   03410 Base excision repair
    106747102
   03420 Nucleotide excision repair
    106747102
   03430 Mismatch repair
    106747102
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dqu03032]
    106747102
   03400 DNA repair and recombination proteins [BR:dqu03400]
    106747102
Enzymes [BR:dqu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106747102
    6.5.1.6  DNA ligase (ATP or NAD+)
     106747102
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106747102
DNA replication proteins [BR:dqu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106747102
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106747102
DNA repair and recombination proteins [BR:dqu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106747102
   NER (nucleotide excision repair)
    Other NER factors
     106747102
   MMR (mismatch excision repair)
    Other MMR factors
     106747102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 106747102
NCBI-ProteinID: XP_014479872
LinkDB All DBs
Position
Unknown
AA seq 841 aa AA seqDB search
MLRTLVICSRLSSLVLPARRLELAARNQFVVVFNRIHATNSNLSDKQEDEDASASGKRKR
DTDDRSSSSPPPSKKLGIKLKEPKPASKTPSPSAKSRAKPGPTSEKKNKISPGKSKKAKG
KILKDISGTKKKEEKDEKVNGAETKQDISTKNGNVEEKEEKEKSVSPIKQKEDTKADKAS
NGKSGNQSYNPSVSRYHPINDACWKRGDKTPYSAFTRTLELIEKTSARLKIIEILSNYFR
SVIVLSPTDLLPSVYLCLNQLAPAYEGIELGVADTNLMKAIAQCTGRTLAQIKADVQQIG
DLGMVAESSRSNQRTMFQPAPLTVPNVYAKLKEIAQMTGHSSLAKKLDKIQTLFVACRNI
EAKYLIRSLAGKLRIGLAEQSVLQALALACAMTPPEQSYPPEIVNASKEMSSERFKEKYD
EIALILKTTYCECPNYNLIIPVLLEDGIKTLPSKCKLTPGIPLKPMLAHPTKGVQEVLTR
FEGLKFTCEWKYDGERAQIHVADDGQVSIYSRNQENNTSKYPDIIGRLKNTRNELVKSCI
LDCEAVAWDNEKKQILPFQVLSTRKRKDANEEDIKVQVCVFMFDLLYLNGEPLVKEPFAK
RRELLKKHFNEIEGEWKFATSLDTSTMEEVQIFLDESVKGNCEGLMVKTLEEEATYEIAK
RSRNWLKLKKDYLDGVGDTLDVVVIGGYIGKGKRTGTYGGFLLACYDQENEEYQSICKIG
TGFKEEDLERHTKFFKDHVIPQTKSYYRFDNSHEPDHWFEPIQLWEIKCADLSLSPVHRA
AIGKVDPEKGISLRFPRFIRIREDKSCEEATSAQQVADMYNNQEQIKNKTSASKAAEEDF
Y
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaacccttgtgatatgctcgcgtttgagctccttagttctaccagctcgacgt
ctcgagcttgcagctcgcaaccaatttgttgttgtttttaatcggatacatgcaaccaac
agcaacttgtccgacaaacaggaggatgaggatgcatcagcaagtggcaaacgcaagagg
gacactgacgatagatcttccagctctcctcctccttcaaagaagctaggtattaaactc
aaagaaccaaaaccagcttccaaaaccccttcaccatctgcaaagtcccgtgcgaagcca
gggcccacttcggaaaagaaaaataaaatttcacctggaaagtcaaagaaggcaaaggga
aaaatattgaaagatatatctggtactaagaaaaaagaggagaaagatgaaaaagtaaat
ggagctgaaactaagcaagatatttctactaaaaatggtaatgttgaagagaaagaggaa
aaagagaaatctgtttcaccaattaagcaaaaggaagatacaaaagctgacaaagcgagc
aatggaaaaagcggcaaccagtcttacaatcccagcgtgtcccgttatcatccgataaac
gatgcatgttggaaacgaggagacaaaactccgtacagtgcatttacgcgcactttggag
cttatcgagaaaacaagcgcgcggctaaagataatagaaatattgtcgaactacttccgc
tccgttatagttctgagcccgacggatcttttgccgagcgtgtatctgtgccttaatcaa
ttggcgccagcgtacgaaggtatcgagctgggagtcgccgacacgaatctgatgaaagcg
atagcgcagtgtactggtagaacactcgcccaaattaaggccgatgtccagcaaatcggt
gatttgggaatggtagcggaaagtagtaggtccaatcagagaaccatgtttcagccggca
ccgttgacggttcccaacgtgtatgccaagttaaaggagatagctcaaatgacagggcac
tcgtctctggcgaaaaagctggacaaaatccagacattgttcgtggcctgtcgcaatatc
gaagcgaaatacctgatcagatcactggctgggaagcttcgtatcggtttagctgagcag
tctgtcttgcaagcgttagccttagcctgtgcgatgacaccgccggaacaatcctaccca
ccagaaatagtaaatgcgagcaaagagatgtcgagtgaacggttcaaagaaaagtacgac
gagatagcgctcatattgaagacaacgtattgcgaatgtccgaactacaatctcataatt
cccgtgctattggaggacggaataaaaaccttgccgagcaaatgcaagctcacgcctggg
atacctctgaaacctatgctggcgcatcctactaaaggcgttcaagaagtgttaacgcga
ttcgaaggcttgaaatttacgtgcgaatggaaatatgacggagagagagcacagatacat
gtcgcggacgacggtcaagtcagtatctacagcagaaaccaagagaacaacactagtaag
tatccggatatcataggccgattgaagaatactcgcaacgaattggtgaagagttgcata
ctcgactgcgaggcggttgcctgggacaacgagaagaaacagattctgccgttccaagta
cttagcacgagaaagcgaaaagacgccaatgaggaggacatcaaagtacaggtgtgcgtg
tttatgttcgatttgctgtacctaaacggtgagccattggtgaaagaacctttcgcgaaa
cgccgtgaattgctgaagaagcacttcaacgaaatagaaggcgaatggaaattcgccacc
agtctggacacttcgacgatggaggaggtgcagatcttcttggacgaatcggtgaaagga
aattgcgagggcctgatggtgaaaacactagaagaagaggcaacttacgagattgcaaag
cgatcgagaaattggttgaagcttaagaaggattacttggacggcgttggtgatacactc
gacgtcgttgtaatcggtggttacatcggcaaaggaaaaagaaccggtacctacggcggt
ttccttttggcgtgctacgatcaggaaaacgaggagtatcagagtatctgcaagatcggc
actggcttcaaggaggaagatctcgagaggcacacgaagtttttcaaagatcacgtgata
cctcagactaaatcgtattaccgtttcgacaacagccatgagccggatcactggttcgag
ccgattcaactttgggagattaaatgcgccgatctctctctttcgccggttcaccgagcg
gctattggaaaagttgatccggagaaaggaatatccctgaggtttccacgatttatcagg
atccgcgaggacaagtcttgcgaggaggccacatccgctcagcaagtggcggatatgtac
aataaccaagaacagattaagaataaaacatcggcgtcaaaagccgcagaagaagatttt
tattaa

DBGET integrated database retrieval system