KEGG   Dinoponera quadriceps: 106747472Help
Entry
106747472         CDS       T05610                                 

Definition
(RefSeq) armadillo segment polarity protein isoform X1
  KO
K02105  catenin beta 1
Organism
dqu  Dinoponera quadriceps
Pathway
dqu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106747472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Adaptin_N Cnd1 HEAT_2 KAP Arm_2 DUF3361 RIX1 PUL Atx10homo_assoc
Motif
Other DBs
NCBI-GeneID: 106747472
NCBI-ProteinID: XP_014480516
LinkDB All DBs
Position
Unknown
AA seq 811 aa AA seqDB search
MSYPMSSNQSRPMSHGNYQGPGDLPMGSAKEQTLMWQQNSYLSDSGIHSGAVTQAPSLSG
KEDEEMEGDQLMFDLDQGFTQGFTQDQVDEMNQQLSHTRSQRVRAAMFPETLEEGIEIPS
TQFDPAQPTAVQRLAEPSQMLKHAVVNLINYQDDADLATRAIPELIKLLNDEDQVVVSQA
AMMVHQLSKKEASRHAIMNSSQMVAALVRAISNSDDLESTKAAVGTLHNLSHHRQGLLAI
FKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNV
KFLAIVTDCLQILAYGNQESKLIILASQGPIELVRIMRSYDYEKLLWTTSRVLKVLSVCP
SNKPAIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAGTKVDGLEVLLQSLVQVLGS
TDVNVVTCAAGILSNLTCNNQRNKVTVCQVGGVDALVRTIINAGDREEITEPAVCALRHL
TSRHGEAEMAQNSVRLNYGIQVIVKLLHPPSRWPLVKAVIGLIRNLALCPANHIPLRDHG
AIHHLVRLLMRAFQDTQRQRSSVASTGSQQTSGAYADGVRMEEIVEGSVGALHILARESH
NRVIIRSQNVIPIFVQLLFNEIENIQRVAAGVLCELAADKEGAEMIEQEGATAPLTELLH
SRNEGVATYAAAVLFRMSEDKPQEYKKRLSMELTNSLFREDTNNLWNNADFSMPPDLQDM
LGPDQGYDGMYGQGPPSVHSSHGGRGYQPQGYDQIPVDSMQGLEIGGGSTYGAMDTMDVA
HEGDLSFDHLEELPAPPQDNNQVAAWYDTDL
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgagctacccgatgtcgtcgaatcaatctagaccgatgtctcacggtaactaccagggt
ccgggcgacctgcccatgggttctgccaaggaacagaccctgatgtggcagcaaaactct
tacctgagtgattcaggtattcactcaggcgctgtcactcaagcgccgtctctgtccggt
aaagaggatgaagagatggaaggggatcaattgatgttcgaccttgaccaaggattcaca
cagggtttcacacaggatcaagtcgatgaaatgaatcagcagctgagtcacacgcggtcc
cagcgtgtacgcgctgccatgttccccgagacgctggaggaaggtatcgaaattccttcc
acgcaatttgatccagcacagcccaccgctgtacagcgactggccgagccgagtcaaatg
ctgaagcatgccgtcgtaaatttgattaactatcaagatgacgctgatctcgcgacgcgt
gctattccagagttgatcaagctcttgaatgatgaggatcaggtggtcgtctctcaggcg
gctatgatggtgcatcagctgtcgaagaaggaagcctcccgtcacgccatcatgaacagc
tcgcagatggtagctgcattagtacgcgccatctccaacagcgacgacctggagtcgacg
aaagccgccgttggcaccttgcacaatttatctcatcacaggcaaggtctgctggccatt
ttcaaaagtggcggcataccagctcttgtgaaactactgagctctccggtggaatcagta
cttttctacgccataacaaccctgcataacttgttgcttcatcaggacggctccaagatg
gctgtgcgtcttgccggaggcttgcagaagatggtcgctttgctacaacgaaacaacgtc
aagttcttggccattgtcaccgattgcctgcagattttggcgtacggaaatcaggagagc
aaattgatcatcctcgcttcgcaaggcccgatagagctggtgcgcatcatgcgctcatac
gactacgaaaaactgttgtggacaacttcgagagtattaaaagtactgtccgtgtgtccc
agtaacaaacccgcaatcgtggaagcgggtggtatgcaggcactcgccatgcatctcgga
aatccgagtcagagattagtgcaaaactgtctgtggacattgcgcaatctgtcggatgct
ggcacgaaagtcgacggactcgaagtcctactgcagagtctcgtgcaagtgctcgggtca
acggacgtgaacgtggtcacatgcgccgctggcattttgtcaaatcttacttgcaacaat
cagcggaataaagtgactgtctgtcaagtcggcggtgttgatgcccttgttcgcacaatc
atcaacgccggcgatcgggaggagatcactgaaccagcggtgtgcgccttgcgccacttg
acttcgcgtcacggagaagcagaaatggcgcagaattctgttcgactaaattacggaata
caagtaatagtgaaattgctccatcctccgtcgcgctggccattggtgaaagcggtcatt
ggattgatccgcaatttggccctctgcccggcgaatcacatcccgctacgcgaccatggc
gcgatacatcatctagtgagacttctgatgcgcgcattccaggatacacagcgacaacga
tcatccgtggctagtaccggaagccaacagacttcgggtgcgtatgcggacggagtgcgt
atggaggagattgtggaaggctcagtgggtgcgcttcatattctggcgagggagtcccac
aatagggtgatcatccgatcgcagaacgtgattccaatcttcgttcaattactgttcaat
gaaattgagaacatccaacgtgtggctgccggtgtactctgcgaattagcggctgacaag
gagggtgctgagatgatcgaacaagagggtgctaccgccccgttgacagagttgcttcac
tccaggaacgagggtgtcgcaacctacgcggcggccgtgttgtttcgcatgagcgaagac
aagccgcaggagtacaaaaaacgactgtccatggagctcacaaattccttgttccgcgaa
gacaccaacaatttgtggaacaatgctgactttagcatgccaccagatctgcaggacatg
cttggccctgatcaaggctatgatggtatgtatgggcaaggacctcctagcgtacacagc
agccatggcggtcgaggttatcaaccgcaaggttatgaccagataccagtagactcgatg
caaggcttagagataggtggtggatccacgtatggtgcaatggacactatggacgtggcg
cacgagggtgatctaagtttcgatcatctggaagagcttcccgcaccgccgcaggataac
aaccaggtagcggcctggtacgataccgatctctaa

DBGET integrated database retrieval system