KEGG   Dinoponera quadriceps: 106748386Help
Entry
106748386         CDS       T05610                                 

Definition
(RefSeq) fatty acid synthase-like
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00061  Fatty acid biosynthesis
dqu01100  Metabolic pathways
dqu01212  Fatty acid metabolism
Module
dqu_M00082  Fatty acid biosynthesis, initiation
dqu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106748386
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dqu01004]
    106748386
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dqu04147]
    106748386
Enzymes [BR:dqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     106748386
Lipid biosynthesis proteins [BR:dqu01004]
 Fatty acid synthase
  Animal type
   106748386
Exosome [BR:dqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106748386
  Exosomal proteins of breast milk
   106748386
  Exosomal proteins of colorectal cancer cells
   106748386
  Exosomal proteins of bladder cancer cells
   106748386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt KR KAsynt_C_assoc Ketoacyl-synt_C Acyl_transf_1 ADH_zinc_N_2 ADH_zinc_N Thioesterase PS-DH PP-binding adh_short Thiolase_N Abhydrolase_6 LIDHydrolase ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 106748386
NCBI-ProteinID: XP_014482327
LinkDB All DBs
Position
Unknown
AA seq 2290 aa AA seqDB search
MDGSKWFNPYMKVPPEEEIVISGIAGRFPGSDNIKELQENLLHKVDLGSDDDRRWNNVNY
DMPARSGKTNNGEKFDAQYFNMTSSEAHVTDPMCRMLLEHTYEAIVDAGINPKELRGTKT
GVFVGSCYSATANIILYHKPQVAGYPFIGCSKYWLANSISHWLGLNGPSYVVDTACSSSH
YAMAEAYRMIRNGECDAAIVGGSNLCLHPHISHQFFRLGVLSVDGYCKPFDESGTGYMRS
EAIAIVYLQKAKDARRIYATYVYAKTNSDGFKQEGITYPSFSMQKKLLEEFYNECDVAPE
MLSYMEAHGTGTPAGDPVEVDAIDQSLCSKRSTPLLMGSVKSNLGHSEPTSGLCQVAKVL
IAMETGIIPPNMHYETPRKEITAICEGRIKIITEPTSWGGGYVGINSFGFGGGNCHVLLK
SNPKNKIKHETSDDLPRLVLVSGRTEEAVKTLLDDVNSRQLDVEYIALLHRLHAENIEGH
PYRGYTIAGSQISQLMKLPMFAKAIETCNATLKQYNICVTDILTNENITACDSILKSFVA
IIATQIGMVDLLTHVGIVPDYIIGHSIGNLICEYIDGRFTVEETILMAYYMGVAFEQANI
QVNDATNNYNSLETVRSKFLELLSYILSSQSLKSRGLIWLGRSRNERDNTPANVAAYYAD
SILYPIPFQEVISLIPKNTVLVEIIPHSGFEPTMAKSLESTLISLCNRDQNTIQSFFQGI
GDLYNIGFQPQIANLYPPVEFPVSRGTPMISPLVRWDHSEDYYFFRYEGQQKIYSRERIV
NITITDEDFDYMSGHVIDGKNLLPATGYLYLIWEMIGLLNGIDHCNIPIVFENVKFVRAT
HLTKNNLELTLMIQEGINNIGNNFEIIEGDNVIVSGVVRIPDNIANEKLPAPFRSEGDDT
EECMCTADIYKELRLRGYQYTGLFRSLKSATITGMVGHIKWQANWVAFMDNMLQMIILSF
DSRSIYLPTQIRKLIIDPTYHMMQLQKLSVEERILPVRVSNCLDVIISGGIEIYGLKATS
ISRRMISTEAVHEEYSFVAYRDHAAISLERAVKMAVHIALECYEMINVKMMEFLEDDDMI
QQDSLITPIIQEVLNNLPLVRSNLTLVAAANRYDSSVLPSNLTTVQLNKLAKDDKFLMII
AVGVLKKGTRDSTNQLLSRIMAGGFLLTREDLNGSYDHALLQRYDLNIIMEKSTEGEVLV
LLRKAQRSVRRREIVHVNNHEFSWIDKLKSAMEVDDESGTNARVIVVAEGDPECGVLGLV
NCLRKEPGGEIVRCIFIQDKDALEFSLQEPFYMNQLQLDLPINVLRPGNVWGSYRHFSLP
LPEPRLVRCGYVVQKVRGDLSTLRWVEGSHNIEPENLVRIVYTTLNFKDVMIATGKLALE
SLAPVGRDVDSLLGFEFVGIDSIGRRIMGICSDRAISNTLLHHNAISWIIPDEWTLEDAA
TVPCVYATCYYSLYKYGKIKKGEKVLIHSGSGGIGQAAINLALHEGCEVFTTVGTPEKRQ
FIRETFPCIPDDHIGSSRDTSFEQMIVRQTRGRGVDIVLNSLAEEKLQASLRCLARGGRF
LEIGKYDLISNNVLNKMAFARGISFHGIMLDRIISAKEEMEAEVFNYLLEGLRNHVIKPL
PRKTFERTEVEDAFRYMATGKHIGKIVIKIRDEDNPLEHPILAHPRFFCEIHKSYVILGG
LGGFGLELADWLILRGARKLLLTSRTGIRNGYQRSRVELWKSYGADVQIVAGADASDRKD
CAFILKSAAKMGPVDVIFNLAVVLRDSIYKNQTVEAFEESFKPKAMATKTLDELSREMCP
DLRRFVVFSSVSCGRGNAGQTNYGMANSIMERICEKRVQDGLPGMAIQWGAVGDVGLVAD
MQEDNNKELIIGGTLQQRIQSCLDSLDAFLMQSRPIVGSMVVAEKRAGFGGVMNILETVA
NVMGVKDLKAVGHRTPLSELGMDSMMAVEIKQTLEREFDVYLTAQDIRNLTFAKLSDMAD
KDKRFAKDNDFTVDSEGGKLFIRLMSNLVMVPDVCLEMPTKQKKERDRVFFLPGVEGCGS
VFNTLASEIQAPATCLQHGTNNIPTCESVVESAAILLPQILTRMKHSKEFIIVGYSYGSV
IAIELVRLLEARNLTGRLILIDGAPDQMKAMKEQHFLFTTIQDFQNKILLALMDTFYVFD
NAMVSVVYCEVLMRLSKYNTWEEKLNVFIDYIPDKAKHVASIENYKIYCTSIYKHLLALH
EYDASSLPSLKSPILLLKPTLASLSSAEEDYGLSKVTEGLVQVHYVEGNHITMLDNYQVA
AAINGDIFIN
NT seq 6873 nt NT seq  +upstreamnt  +downstreamnt
atggacggtagcaaatggtttaacccatatatgaaagttcctccagaggaggaaattgtg
atttccggtatcgcaggacgatttcccggctctgataatataaaggaactacaagaaaat
cttttgcataaggtggacctcggttcagacgacgatagacgatggaacaatgtaaattac
gacatgcctgctcgatccggaaagactaataatggagagaagtttgacgcgcaatatttc
aacatgacatcttcggaagcgcacgtcactgatcctatgtgcaggatgttgcttgagcac
acttacgaagcgattgttgatgccggtataaatcccaaagaattaagaggaacgaaaact
ggtgtcttcgtaggatcgtgttactctgcgacagcaaacataattctctatcacaagcct
caagtagctggatacccatttattgggtgcagtaaatactggttagcgaacagcatttct
cactggctcggccttaatgggccatcttatgtcgtggatacggcctgcagttcaagtcac
tacgccatggcggaagcttacaggatgatacgaaatggagaatgcgacgcggccatcgta
gggggctccaatctttgcctgcatccccatatttcgcatcaattcttccgtctcggagtt
ctctccgttgatggttactgcaagccattcgacgagtctggtactggatatatgcgcagc
gaagctatcgcgatagtatatctccagaaagcgaaggatgcaaggcgaatctatgctacc
tacgtctacgctaaaaccaattctgatggctttaagcaagaaggcattacatatccctct
ttcagcatgcagaagaagttattagaagagttttataacgaatgcgatgttgcacccgaa
atgctctcctatatggaggcccatggaactggtactccagcaggagatccggtagaagtt
gacgccatcgaccagtccttatgttcaaaaaggtctactcctttgttgatgggttcggtg
aagtcgaatcttggtcattcggagcctaccagtggtctttgtcaagtagcaaaagtattg
atagcaatggaaaccggtataatcccgccaaatatgcactatgaaaccccgcgaaaagaa
attactgctatatgcgaaggtagaataaagatcatcacagaacctacttcatggggcggt
ggttacgtgggtattaattctttcggatttggcggtggcaattgtcacgtattattgaag
tcgaatcccaaaaataaaataaaacatgaaacatcggacgatttaccgagacttgtactt
gtatctggtcgtactgaagaggctgtgaaaactcttttagatgatgtgaatagtcgacaa
ctggatgtggaatatatcgctcttttgcaccgtctgcatgctgaaaatatagagggtcat
ccgtacaggggatatactatagctggatctcaaataagccaattgatgaaactgccgatg
ttcgccaaggcaattgagacatgtaatgcaacattaaagcagtacaatatatgcgtcaca
gatattttaacgaacgaaaacataactgcttgcgacagtattttaaaatcgtttgtagcg
atcattgctacacagattggaatggtggatctcttaacgcatgttggtatcgtgcccgat
tacattattggtcattctattggtaacctgatctgcgaatatattgatggacgtttcact
gtcgaagaaacgattttaatggcgtattacatgggcgttgcatttgaacaggccaacata
caggttaacgatgctacgaataactacaactctcttgagactgtcagatcaaaattcttg
gagcttctcagctatatattatcatcgcagtctttaaaaagtcgcggtctgatatggttg
ggcagatctcgtaatgaacgggacaacacacctgcaaatgtagcagcatattatgctgac
agtatattgtatccaataccattccaagaagttatatctttgataccgaaaaatacggta
ctcgtcgagataataccacacagtggtttcgaacctactatggcaaagtcgttggagtca
acgttgatttcactatgcaatcgcgaccagaataccatacaaagttttttccaaggaatt
ggagatctttataatataggttttcagccgcagattgcaaatttgtacccgccggtggaa
tttccggttagtcgcgggacaccaatgatatctcctctcgtcagatgggatcattctgag
gattattacttctttcgttatgaaggacagcaaaagatttacagcagagaaagaatcgtt
aatattacaatcactgacgaagacttcgattatatgtctggtcatgtgattgatggaaag
aatttgttaccggctacgggttatctttacttaatttgggagatgattggtttgttaaac
ggaatcgatcactgcaacataccgattgtatttgaaaatgttaaatttgttcgtgctact
cacttaacaaaaaataacctggaattaactcttatgatacaggaaggcattaataatata
ggtaataacttcgaaatcatagagggtgacaatgtcattgtcagtggagttgtgagaata
cctgacaacatcgcgaatgaaaaattacccgctccttttcgatccgagggcgatgatact
gaagagtgcatgtgcacggcagatatttacaaggagctacgactacgtggatatcaatat
acaggtttattccgttcgttgaagagcgccacgattactggtatggtaggacatatcaaa
tggcaagctaattgggtggcatttatggacaatatgctgcaaatgataatcctgtcattc
gactcgagaagtatttacctgccgacccaaattcgaaaattaataatcgaccctacctat
catatgatgcagttgcagaagctgtccgttgaagaacggattctgcccgtacgtgtcagc
aattgcctggatgttataatatccggaggaatagaaatttatggacttaaagctacgtcc
atatctcgtcgaatgattagcaccgaagcagtgcacgaggaatatagtttcgttgcttat
cgggatcatgccgcgatatctttagaaagggcggtaaaaatggcggtgcacatcgcgctt
gaatgttacgaaatgataaatgttaaaatgatggagttcctcgaggacgacgacatgatc
cagcaggatagtctaattactccgattatccaggaggtcctaaacaatttgccgctagtg
cgatctaatctcacattggtcgcggcggccaacagatacgacagctccgttttgccttcg
aatctcacgacagtgcagcttaacaaactagcgaaagatgacaaatttctaatgatcatt
gcagtcggagtactaaagaaaggtacgcgcgactcaaccaatcaattattgtccagaata
atggctggaggttttctcttgacacgagaagatctcaacggctcttacgatcatgcgtta
ctgcaacgctacgatctgaacatcatcatggagaaaagtacggaaggagaagtgctggtg
ctcttgagaaaggcgcaaagatccgtgagaagacgggaaatcgtacacgtaaacaaccac
gaattctcgtggatcgacaagctcaaatctgccatggaggtggacgacgaatcaggcacg
aacgccagagtaatagtcgtcgcggagggtgatcccgaatgtggtgtattaggacttgtt
aattgcttacgaaaggagccgggtggcgaaattgttagatgcatatttattcaagataag
gacgcacttgagttttctttgcaagaacctttctatatgaatcagttgcaattggattta
cctattaacgtcttacgtcctggtaatgtttggggctcatatcggcacttttcgttacca
ttgccggaaccaagactcgtgcggtgcggttacgtcgttcaaaaggttcgaggtgacttg
agtacgcttcgttgggtcgaaggatctcacaatatcgaacctgaaaatcttgtacgtata
gtttatacgacactgaatttcaaagacgtcatgatagctaccggtaaacttgctttggaa
tcccttgcaccggttggacgggacgtcgattccttattaggttttgaatttgtcggtatt
gatagcattggacgaagaataatgggaatatgctcggacagagcaatatcaaatacctta
ttgcatcataacgcaatatcctggattatacctgacgaatggaccttggaggacgccgcc
acagttccttgcgtttacgccacatgctactattctttatataagtatggaaagataaag
aaaggggagaaagtactcattcattcgggtagcggtggcatcggtcaggccgcgattaat
ctagcgcttcacgaaggatgcgaagtatttacgacagtcggaactccagagaaacgacag
ttcattagagaaacattcccctgcattcccgacgatcatatcggcagttctcgcgacaca
agtttcgaacaaatgatcgttcggcagacacgaggacggggtgttgacatcgtattgaat
tctctggctgaagaaaagctccaagcatcccttcgctgtttagcgagaggcggtcgattc
ttggaaattggcaaatatgatctaatttctaataatgttctcaacaaaatggcgtttgcg
agaggcattagttttcatggaattatgttagacagaataatcagcgccaaagaagaaatg
gaggcagaggtgttcaattatcttttagaaggtttgagaaatcatgtgataaaaccgctc
ccgaggaagacgttcgaaaggaccgaagtagaagatgctttcaggtacatggcaaccggt
aagcacataggaaagatagtgattaaaatacgcgatgaagacaatccgttggaacatcct
attctcgctcatccccgatttttctgcgagatccataaatcttacgtcattctgggcggc
ctgggcggcttcggactggaattagcggactggctgattcttcgcggagcccgaaaactc
ctgttaacttcgcggactggaatacgtaacggctatcagcgctcgagagtggaactatgg
aagtcttacggagcggatgttcagatcgtcgcgggtgctgatgcgtccgatcgcaaggac
tgtgcgtttattttgaaatccgctgcgaaaatggggccagtggacgttatatttaacctc
gcggttgtactcagagattccatctacaagaaccaaaccgtggaggccttcgaagagtca
ttcaagccgaaggcgatggcaacgaagacgttggacgagctctcgagggagatgtgtccc
gatctccggcgcttcgtcgttttctcttccgtttcatgcggccgaggaaatgcggggcaa
actaattacggcatggctaattccattatggagagaatatgcgaaaaaagagtacaggac
ggtttacctgggatggctatacaatggggcgcggtgggcgatgttggactcgttgctgat
atgcaagaggacaataataaggaactcattatcggcggtacactgcagcaaaggatacag
tcctgtctggattcactggacgcttttctgatgcagagtcgaccgatcgttggtagtatg
gtcgtagctgaaaagcgcgcgggcttcggcggagttatgaatattctggagaccgtagcg
aatgtcatgggggtgaaggatttaaaagcggtcggacatcgcaccccattatctgagctc
ggcatggactcgatgatggctgtggagattaagcaaacgttggaacgagaattcgatgtt
tatcttaccgcgcaagatattcgaaatctcactttcgcaaaactgagcgacatggccgac
aaagacaagcgttttgcaaaggacaacgatttcactgtagattcggagggtggaaaactc
tttattcgtttaatgagcaatttagtcatggttccggacgtttgtctagaaatgcccacg
aaacaaaagaaggagagagatcgtgtattctttctacctggtgtcgaaggttgtggaagc
gtgtttaatacattggcttcggaaatccaggctcccgcaacgtgtttgcagcatggcacg
aacaatatccccacgtgcgaatcggtggtggagtcagctgctatcttattaccgcaaatt
ctgacgaggatgaagcattctaaagaatttataatagtcggatattcgtatggatcagta
attgctattgagctggtgagactgttagaggctagaaatctcacaggacggttaatatta
atcgacggcgctcccgatcagatgaaagctatgaaagaacaacatttcctttttaccact
attcaagattttcagaataaaattctcttagctctaatggacacgttctacgtgtttgac
aatgcaatggtatctgtagtatattgtgaggttttaatgagattgtccaaatacaacacg
tgggaggaaaaattgaacgttttcatcgactatattcccgacaaggctaaacatgtagct
tctattgagaattacaaaatatattgcacatctatttataaacatctactcgctcttcac
gaatacgatgcttcttcattgccgtcattgaaatcacctatattgttattaaaacctaca
ttagcatctttgtcttctgccgaggaagattacggcttgagcaaggtgactgaaggttta
gtacaagttcattacgtggaaggcaatcatatcacgatgttggacaattaccaagttgct
gctgctattaacggagatatttttataaactag

DBGET integrated database retrieval system