KEGG   Dinoponera quadriceps: 106748818Help
Entry
106748818         CDS       T05610                                 

Definition
(RefSeq) translocation protein SEC63 homolog
  KO
K09540  translocation protein SEC63
Organism
dqu  Dinoponera quadriceps
Pathway
dqu03060  Protein export
dqu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    106748818
   04141 Protein processing in endoplasmic reticulum
    106748818
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dqu03110]
    106748818
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dqu02044]
    106748818
Chaperones and folding catalysts [BR:dqu03110]
 Heat shock proteins
  HSP40 / DNAJ
   106748818
Secretion system [BR:dqu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   106748818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ
Motif
Other DBs
NCBI-GeneID: 106748818
NCBI-ProteinID: XP_014483179
LinkDB All DBs
Position
Unknown
AA seq 761 aa AA seqDB search
MSGQKFQYDESGGTFFYFLLSFLALLLIPGTYYLWPRQPKQDPDQLAKECQCNGCKKKKL
ILQSNKPWKNTKALFVKFLIIMGWVILILLAYKVSQFDYEMANFDPFEILSIPPGSSQNE
IKRAYRKLSLILHPDKETGDEKAFMKLTKAYQALTDDEARKNWEKYGNPDGPGAMSFGIA
LPSWIVEKENSLWVLGLYGLVFMVALPTVVGMWWYKSIRYTGDQILLTTTEMYYFFFVKT
PSMTLKRVIMILAASFEFFKKRNAEVVERDTDNEEIPSLIKQLPNLGEKNKEVPLCNMYS
IKARALLHAHLSRIPLNPETLDKDRQYIVKKCPYLIQEMVGCIHQVILLAYARRVPRVPT
ITTIENCMKLCPMIVQGFWEFKNPLLQLPHITEDNLKYFLAKKRQIKSLQQFAQLKGEER
RLILRNLSDSQYEDVMKVLGNMPYIDFKVRSEVIDDENPTVYTAGAIVTVTVSLTRKDMK
HLFGDDSINEQTMIDDNKTNAEMIDEMSEEQNQSAKAAKPAWLKKKKGQKKSHKKSINKK
AAPTKNVQTPSQTVANNTQHAGNAVNAKKKDDKSEKESSKEKLSDVSDSEVESDRSDDED
SHDKKDMSLDDDDTEWEKFQQKITKRERVLEGRSNLSHEVHCPLFPDVKQEYWWVYICDR
KSQTLLTTPVHVTSLVQFEEVQLKFTAPRWPGLYTFTVCLRSDSYLGFDQAQDIKLDVKE
APEIPTEHPQWDISDEETAEDVDAADEHSEFTTDEDISDNE
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacagaagtttcagtatgacgagagcggtgggacattcttttacttcctgctg
tcgttcctggcgttattgctgatacccgggacctactatctttggccacgccagccgaaa
caagatcccgaccagttagccaaagaatgccagtgcaatgggtgcaaaaagaaaaaactt
attctccagtcaaacaaaccatggaaaaataccaaggctttatttgtaaaattcctaatt
attatgggatgggttattttgatacttttggcatacaaagtctcgcagtttgattatgaa
atggccaactttgatccatttgaaatattaagtataccacctggttcttcacaaaatgaa
attaagagggcttatcgtaagctctcattaattctccatcctgataaagaaactggagat
gaaaaagcatttatgaaattaactaaagcttaccaagctctaacggacgatgaagcacga
aaaaattgggagaaatatggaaatccggatggtccaggagcaatgagttttggtatagct
ttgccttcttggattgtcgaaaaagaaaactcgttatgggtcttaggattgtatggatta
gtgttcatggttgctttaccgacagttgtaggaatgtggtggtacaaaagtattcgctac
acgggtgaccaaattcttttaacgaccactgaaatgtattactttttcttcgtgaaaacg
ccgtctatgacattaaaaagagtcattatgattctcgctgcttcctttgaattcttcaag
aaacgcaatgcagaagtggttgaaagagacaccgataatgaagaaattccttcgctcatc
aaacagttacctaacttaggggaaaaaaacaaagaagtaccattatgtaatatgtattca
attaaagctagagccttattacatgcgcacttatcgcgtataccactcaaccctgaaaca
ttagataaagacaggcaatatattgtaaagaaatgtccatatttaatccaagaaatggtt
ggatgtatccatcaagtcatacttttagcttatgctagaagagtaccacgggtgccgacc
ataacaactatagagaactgcatgaaactgtgtccgatgattgtccaaggattctgggag
ttcaagaatcccctccttcaattaccacacataactgaagacaatctgaaatacttcctc
gcaaagaagcgtcaaatcaaaagtcttcagcaattcgcacaactgaaaggagaagaacga
agactgatacttagaaatctgtcggacagccaatacgaggacgttatgaaagttctcgga
aatatgccgtatatagatttcaaagtacgatctgaagtaatcgacgatgaaaatcctact
gtctatactgctggtgctattgtaactgtaacagtatcattaacgcgaaaagatatgaaa
catctttttggagatgattccatcaatgagcaaacgatgatcgacgataacaaaacgaat
gcagaaatgatcgacgagatgtcagaggagcaaaatcaatctgcgaaagccgcgaagcca
gcgtggctcaagaagaagaaaggtcaaaagaagtctcacaagaagagtatcaataagaag
gcagctcctactaaaaatgttcaaacaccatcccaaactgtggccaacaatactcaacac
gcaggtaatgctgtcaatgcgaaaaagaaggacgataagtcggagaaagagtcttccaaa
gagaagttgtccgatgttagtgacagcgaagtcgaaagtgacaggagcgacgacgaggat
agtcacgataagaaggatatgtctctcgatgacgatgatacagaatgggaaaagttccaa
cagaaaattaccaagcgggaaagagtattggaaggcaggagcaatttgtcacacgaagtg
cactgtccgctctttcccgacgttaaacaagaatattggtgggtctatatctgtgatcga
aaaagtcaaacgctattgacaacccctgtacacgtcacgtctttagtgcaattcgaagag
gttcagttaaaatttacagcaccgcgctggccgggtctttacacatttactgtgtgttta
cgtagcgactcatatcttggcttcgaccaagctcaagatatcaagttggacgtgaaagaa
gcaccggaaataccaacggagcatccacagtgggacatctcggatgaggaaaccgcggag
gatgtagatgcagccgatgaacattccgagttcacaactgacgaagacattagtgacaat
gaataa

DBGET integrated database retrieval system