KEGG   Deinococcus radiodurans: DR_0020Help
Entry
DR_0020           CDS       T00025                                 

Definition
(RefSeq) ribonuclease II family protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
dra  Deinococcus radiodurans
Brite
KEGG Orthology (KO) [BR:dra00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dra03016]
    DR_0020
Enzymes [BR:dra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     DR_0020
Transfer RNA biogenesis [BR:dra03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    DR_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB RNase_II_C_S1
Motif
Other DBs
NCBI-GeneID: 1797537
NCBI-ProteinID: NP_293746
UniProt: Q9RYD0
LinkDB All DBs
Structure
PDB: 

Position
1:19258..20643
Genome map
AA seq 461 aa AA seqDB search
MTQPELTPAQRTEVELLARGRADKSRVLRDLKLPETPEAAHALLLRLGVWDEARTPYADR
LRAALNAVELPVPDFDPAEERLDLTHLPTFAIDDEGNQDPDDAVGVEDLGGGLTRLWVHV
ADVAALVAPDSPLDLEARARGATLYLPDRTIGMLPDELVAKAGLGLHEVSPALSICLDLD
PDGNAEAVDVLLTRVKVQRLAYQEAQARLEAGEEPFVTLARLARASRRLREGEGALSIDL
PEVRVKADETGASVFPLPKPEMRTVVQECMTLAGWGTAIFADDNEIPLPFATQDYPTREV
AGDTLPAMWARRKTLARTRFQPSPGPHHGMGLDLYAQATSPMRRYLDLVVHQQLRAFLAG
RDPLSSKVMAAHIAESQMNADATRQAERLSRRHHTLRFIAAQPERVWDAVVVDRRGAQAT
LLIPDLAFDVQVNTPAAPGTALQVQFADIDLPQMRVRARSV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcccgaactcacccccgcccagcgcaccgaggtggaactcctcgcccggggc
cgcgccgacaagagccgcgtcctgcgcgacctgaagctgcccgaaacgcccgaggccgcc
cacgcgctgctgctgcgcctcggcgtctgggacgaggcccgcaccccctacgccgaccgc
ctgcgcgccgctttgaacgcagtggagttgccggtgcccgacttcgaccccgccgaggag
cggctcgacctgacccatctgcccaccttcgccatcgacgacgaggggaaccaggacccc
gacgacgcggtgggcgtggaagacctcggtggcggcctgacccggctgtgggtgcacgtg
gccgacgtggcggctctggtggcccccgacagcccgcttgacctcgaagcgcgggcacgc
ggcgccaccctctacctgcccgaccgcaccatcgggatgctgcccgacgaactggtggcg
aaggcggggctgggcctgcacgaggtgtctccggcgctctccatctgtctcgacctcgac
ccggacggcaacgccgaggcggtggacgtgctgctgacgcgcgtgaaggtgcagcgcctc
gcctatcaggaggcgcaggcccggctggaggcgggcgaggaacccttcgtcacgctcgcc
cgcctcgcccgcgccagccgccgcctgcgcgagggcgaaggcgcgctgtccatcgacctg
cccgaagtgcgcgtgaaggccgacgagacgggcgcctccgtctttccgctgcccaagccc
gagatgcggacggtggtgcaggagtgcatgacgctggctggctgggggaccgccatcttt
gccgacgacaacgagattcccctgcccttcgccacccaggactaccccacccgtgaggtg
gcgggcgataccctgcccgcgatgtgggcgcggcgtaagacgctggcccgcacccgcttt
cagccctcgccagggccgcaccacgggatgggcctcgacctctacgcccaggcgacgagc
cccatgcgccgctacctcgacctggtggtgcaccagcagttgcgggccttcctggcgggc
cgcgacccgctgagcagcaaggttatggccgcgcacatcgccgagtcgcagatgaacgcc
gacgccacccggcaggccgagcgcctcagccgccgtcaccacaccctgcgcttcatcgcc
gcgcagccggagcgcgtgtgggacgcggtggtggtggaccgccggggggcacaggccacg
ctgctgattcccgacctcgccttcgacgtgcaggtaaacacgcccgccgctcccggcacc
gcgctgcaggtgcaatttgccgatatcgacctgccgcaaatgcgggtgcgggcgcgcagc
gtctga

DBGET integrated database retrieval system