KEGG   Deinococcus radiodurans: DR_1283Help
Entry
DR_1283           CDS       T00025                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dra  Deinococcus radiodurans
Pathway
dra00620  Pyruvate metabolism
dra00680  Methane metabolism
dra01100  Metabolic pathways
dra01120  Microbial metabolism in diverse environments
dra01200  Carbon metabolism
Module
dra_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR_1283
  09102 Energy metabolism
   00680 Methane metabolism
    DR_1283
Enzymes [BR:dra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DR_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 1799219
NCBI-ProteinID: NP_295007
UniProt: Q9RUU8
LinkDB All DBs
Position
1:1288239..1290728
Genome map
AA seq 829 aa AA seqDB search
MALNNDVNRLGRILGQVLKEQEGEAFFNLVEQTRTLVREVRAGGDPAQLNALLGSLSEND
ASNLARAFTWYFQLVNIAEEYERVRVLQSRSGVRSQSLAQALADLREQGLSAEDVENLLA
RVNLELTFTAHPTEMRRRTVRSHLEHIARELPDLGRESAQERVAAHVEALWRTPELRRLK
PTVLDEVKGGLNYISTIAQALPKLERDLSDAFQATYGRETAAHVPLRFSSWMGGDRDGNP
FVTPEATREALQLHRERARELLLAALRQAYTDLSQEEEEDAAEGTYRTELRALHNAVRDG
EPVELLPRLEALNARLHADGQERTAWQLLMPLLSVARVFGQHLVSLDIREHSGQTGAAVA
ELLKAAGVEADYLGLSEDAKLELLTRELRSHRPLWPAGATFTETLEAVIGPIREVQAAAR
RVGPLAFGHYVISMSESVSDILEPLILAREVGFRVLPVPLFETLDDLQHAPRIVTDLLAL
PEYRAVLGDDMQEIMIGYSDSNKDAGFLAANWALHEAQRTISDVCRRAGVRWRFFHGRGT
SIGRGGGPASRAILGQPAGTIDAGVRITEQGEALADKYSHPVLARRNLEQALYGVLLAAA
RPVGDPPADFMAAMTRAAEASATAYRDFVHDPDFLPFFERVTPIHEISRLNIASRPVRRP
GAPTLGNLRAIPWVMSWTQNRANLPGWYGLAEGLAEIGPELAAKMYAEWPFFHSMLDNAQ
MSLAKSDPLVFAEYLTLLEGASTRLADHLRESYARTVAAVESVIGGELMLGEQRLKESIA
LRNPYIDPIHRLQVELLRRSRSHEGGLDEYERPLLLTLQGIAAGVRNTG
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggcactcaacaacgatgtcaatcgcctgggccgcattctcggtcaggtgctcaaagag
caggaaggcgaggcgtttttcaacctcgtggagcagacccgcaccctggtgcgcgaggtg
cgggccgggggtgaccctgcccagctcaacgcgctcctcggcagcctgagcgagaacgac
gcgtccaacctcgcccgcgcctttacctggtatttccagctcgtcaacatcgccgaggag
tacgagcgggtgcgcgtcttgcaaagccgcagtggggtcaggtcgcaaagcctcgcgcag
gcgctggcggacctcagagagcagggcctgagtgccgaggacgtggaaaacctgctcgcc
cgcgtgaacctcgaacttaccttcaccgcccaccccaccgagatgcgccgccgcacggtg
cgctctcacctcgagcacatcgcccgcgagctgccggacctcggacgcgaatcggcgcag
gagcgcgtcgccgcccatgtggaagcgctgtggcgcacgcccgagctgcgccgcctcaag
cccaccgtgctcgacgaggtcaagggcggcctcaactacatttcgaccatcgcgcaggcg
ctgcccaagctggagcgcgacctgagcgacgcttttcaggccacctacgggcgcgagacc
gcggcccacgtcccgctgcgcttttcgtcgtggatgggcggcgaccgcgacggcaacccc
ttcgtgacgccggaggccacccgcgaggcgctgcaactgcaccgcgagcgggcgcgggaa
ctgctgctcgcggcgctgcggcaggcgtacaccgacctcagccaggaggaggaagaggac
gccgccgagggcacctaccgcaccgaactgcgcgccctccacaacgccgtgcgcgatggg
gaaccggtggagctgctcccccgcctcgaagccctgaatgcccgccttcacgccgacggg
caggagcgcaccgcctggcaactgctgatgccgctgctctcggtggcccgcgtgttcggg
cagcacctcgtgagtctggacatccgcgagcattccgggcagaccggggcggcggtggcc
gaactgctgaaggcggcgggcgtggaggccgattatctgggcctctccgaagatgccaag
ctggagcttctgacccgcgaactgcgctcgcaccgcccgctgtggcctgccggggccacc
ttcaccgagacgctcgaagccgtcatcgggccgattcgggaagtgcaggccgccgcgcgg
cgggtggggccgctcgccttcgggcactacgtcatctcgatgtccgaaagtgtctccgac
attctcgaaccgctgattctcgcccgcgaggtcgggttccgggtgctgccggtgccgctg
ttcgagacgctcgacgacctacaacacgccccccgcatcgtcaccgacctgctcgcgctg
cccgagtaccgcgcggtgctgggggacgacatgcaggaaatcatgatcggctactccgac
tccaacaaggacgccgggttcctggccgccaactgggccctgcacgaggcgcagcgcacc
atcagcgacgtgtgccgccgcgcgggcgtccgctggcgcttcttccacgggcgcggcacc
tccatcgggcgtgggggcgggccggcgagccgggcaattctgggccaacctgccggaacg
attgacgcgggcgtgcggattaccgagcagggcgaagcgctcgccgacaagtacagccac
ccggtgctggcgcggcgcaatctggaacaggccctttacggcgtgctgctcgcggcggcc
cggcccgtgggcgacccccccgccgactttatggccgccatgacccgcgcggcggaggcg
agtgccacggcctaccgcgacttcgtgcatgatccggacttcctgcctttcttcgagcgg
gtcacgcccatccacgaaatcagccgcctgaacatcgcctcgcgcccggtgcgccgcccc
ggtgcgcccacgctgggcaacctccgtgccattccctgggtcatgagctggacgcaaaac
cgcgccaacctccccggctggtacgggctggccgaggggctcgctgaaatcggccccgag
ctggcagcgaagatgtacgccgagtggccttttttccactccatgctcgacaacgcgcag
atgagcctcgccaagagcgacccgctggtgttcgccgagtacctgaccctgctggaaggc
gccagcacccggctggccgaccacctgcgcgagagctacgcccgcacggtggcggcggta
gaaagcgtcatcggcggcgaactgatgctgggcgagcagcggctgaaagaaagcatcgcg
ctgcgtaacccctacatcgacccgattcaccgcctgcaagtcgaactgctgcgccgctcg
cgctcgcacgaaggcggcctggacgagtacgagcgtccgctgctgctcacgctgcaagga
atcgcggcaggggtgcggaatacgggctga

DBGET integrated database retrieval system