KEGG   Danio rerio (zebrafish): 100000252
Entry
100000252         CDS       T01004                                 

Gene name
pik3r3b
Definition
(RefSeq) phosphoinositide-3-kinase, regulatory subunit 3b (gamma)
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100000252 (pik3r3b)
   04370 VEGF signaling pathway
    100000252 (pik3r3b)
   04068 FoxO signaling pathway
    100000252 (pik3r3b)
   04070 Phosphatidylinositol signaling system
    100000252 (pik3r3b)
   04150 mTOR signaling pathway
    100000252 (pik3r3b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100000252 (pik3r3b)
  09143 Cell growth and death
   04210 Apoptosis
    100000252 (pik3r3b)
   04218 Cellular senescence
    100000252 (pik3r3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100000252 (pik3r3b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100000252 (pik3r3b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100000252 (pik3r3b)
   04625 C-type lectin receptor signaling pathway
    100000252 (pik3r3b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100000252 (pik3r3b)
   04914 Progesterone-mediated oocyte maturation
    100000252 (pik3r3b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100000252 (pik3r3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    100000252 (pik3r3b)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100000252 (pik3r3b)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Bap31_Bap29_C OB_RNB Transcrip_act
Other DBs
NCBI-GeneID: 100000252
NCBI-ProteinID: NP_957437
ZFIN: ZDB-GENE-040426-743
Ensembl: ENSDARG00000034409
Vega: OTTDARG00000019978
UniProt: Q66I41
LinkDB
Position
6
AA seq 464 aa
MYNTVWNTEKEDDDWRDVMMPYSTELIFYIEMDQPPALPPKPTKPMTPVNGNGVKEAASG
SLQEAEWYWGDISREEVNDKLRDMPDDTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHR
DGKYGFSDPLTFNSVVELISHYRHESLAQYNTKLDVKLMYPVSRYQQDQLVKEDNIDAVG
RKLQEYHNQYQEKSKEYDRLYEEHTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSK
EYIERFRREGNDKEIERIMMNYEKLKSRLGEIHDSKTRLEQDLKTQALDNRETDKKMNSL
KPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGLKNETTDDAYFVSEEDENLPHYDEKSW
FVGDLNRTQSEDLLHGKPDGAFLIRESSKKGCYACSVVVEGEVKHCVIYSTPRGFGFAEP
YNLYSTLKDLVLHYHQTSLVQHNDSLNVRLAYPVYAQMPSGPRR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtacaatacagtgtggaatacggagaaagaagatgacgactggagagacgtgatgatg
ccctattccactgaattaatattttacattgaaatggaccagccgccagctcttcctccc
aagccaacaaaacccatgacaccagtaaacggcaatggtgtgaaagaagccgccagcggc
tcactgcaagaagcagaatggtactggggagacatatcaagggaagaggtgaatgataaa
ttgcgagacatgcctgatgatactttcctggtacgggacgcttcaaccaagatgcaggga
gattacacattaacgctaaggaaaggtggaaacaataagctaataaaaatctaccatcga
gatgggaagtacggattctcagacccgctcacgtttaactcggtggtggagctcatcagt
cactacagacatgagtcactggcccagtacaacacaaaactggacgttaagctcatgtat
ccggtctcccgctaccagcaggatcagctggtgaaagaggacaacattgatgcagtggga
aggaagctccaggagtatcacaatcaatatcaggagaagagtaaagaatatgacagactc
tacgaggagcacacaaaaacctcacaggagatccagatgaaacgtaccgcaatagaggcc
ttcaatgagactattaaaatttttgaagaacagtgtcacacacaggagcgctacagtaag
gaatacattgagcgattccgcagagagggcaacgacaaagagattgagaggattatgatg
aactacgagaagcttaaatcccgtctgggtgaaattcacgacagtaagacccggcttgaa
caggacctgaaaacgcaggctctggataacagggagacggacaagaaaatgaacagctta
aagccagatctcattcagctccgaaagattagagatcagtaccttgtttggctaaatcat
aaaggtgtacgacagaaacgaataaacgattggctgggcttaaaaaatgagaccacagat
gatgcctactttgtcagtgaggaggatgagaatctgccacactatgacgagaagagctgg
tttgtgggggacctgaaccgaacacagtcagaagatttgctacatggcaaacctgacgga
gctttcctcatccgagaaagcagcaagaaaggctgttacgcctgctctgttgttgtggaa
ggcgaggtgaagcactgcgtcatctacagcacaccccgcggcttcggctttgccgagccc
tacaacttgtatagcactcttaaagacttggtcctgcactaccaccagacctcactggtc
cagcacaatgactcgctcaacgtgcggctggcgtacccagtgtatgcacagatgccctca
ggaccccggagatga

KEGG   Danio rerio (zebrafish): 100002263
Entry
100002263         CDS       T01004                                 

Gene name
pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100002263 (pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100002263 (pik3cb)
   04370 VEGF signaling pathway
    100002263 (pik3cb)
   04068 FoxO signaling pathway
    100002263 (pik3cb)
   04070 Phosphatidylinositol signaling system
    100002263 (pik3cb)
   04150 mTOR signaling pathway
    100002263 (pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100002263 (pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    100002263 (pik3cb)
   04218 Cellular senescence
    100002263 (pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100002263 (pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100002263 (pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100002263 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    100002263 (pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100002263 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    100002263 (pik3cb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100002263 (pik3cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100002263 (pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    100002263 (pik3cb)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100002263 (pik3cb)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100002263 (pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 RWD DUF4135
Other DBs
NCBI-GeneID: 100002263
NCBI-ProteinID: XP_005157523
ZFIN: ZDB-GENE-030131-1904
Ensembl: ENSDARG00000075253
Vega: OTTDARG00000039767
UniProt: E7F251
LinkDB
Position
15
AA seq 1080 aa
MPPAKTDQLDLWAESGLDGDDQVMVDFLLPTGIYIQMEVPRESTIQHIKLLLWKEAQTYP
LFSLLGEMEGHMFECVNQAAVHEELEDETRRLCDVRPFLPVLKLITRNCGRAERLLDSKI
GVLIGKGLHELDALQDQEVKDFRSKMKRISEEKMQQMQMMSWGQWLRSSYSPQLDTSSLD
NLIERHEGIIKITMHYDQSQDTASLKVSLNCTVSEVMDHALKKWQTTHGPEEDIGARSNY
VLRVSDRLEFLFEDYPLIQYKYIRACLSTGENPHLTVVHFDIVKSMFEKEIATVGSVLAR
KTSNPPLPLPPKKRQTTVRTSSMSASQLPQQLHTCVWKVHSLFRINLVKANKVNAEDAAK
IQVRAGLFHGTELLCKTAVSNESSSRSEHVWNKTLEFDIPVCDLPRMARLCFAIYAVMDK
VKKQRSTKNTHLNKYQTIRKAGKVHYPIAWVNTMVFDYRGQLKTGDIILHCWSSFPDELE
EMLNPIGTIQTNPYTENATELHISFPEYSTQPVVFPAFDKILEKAAEIAGASDSMSMGRG
GKKFYIELKEIMERDPLSQLCENEKDLIWTLRYDCRENFPQSLPKLLLSVKWSKHEDMAQ
LQALLQIWPKLSPRDALELLDFNYPDQYVREFAVSCLKDMSDDELLQYLLQLVQVLRYEP
YYDCSLSRFLLERAQTSRKIGHFLFWHLRSEMYMPAVSVHFALILEAYCRGCIPHIEVLK
KQVEALNKLKAVNELIKLGTIKTKTKQAHLKEAMMSCLRQTGFIETLSDLHSPLNPNILL
AGVSVEKCKYMDSKMKPLWIVYNNKLLGGETVGIIFKNGDDLRQDMLTLQILKLMDLLWK
EANLDLRIVPYGCLATGDHSGLIEVVSSADTIANIQKTSSNMAAAAAFNKDALLNWLKDK
NSGDALDKAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSK
FGIKRERVPFILTHDFIHVIQEGKTGNTEKFGNFRQYCEEAYMILRKNGNLFITLFALML
TAGLPELTSVKDIQYLKDSLALGKTDEEALKQFRQKFDEALRESWTTKVNWMAHIVAHPS
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgcctcccgcaaagacagatcagctggacttgtgggcggagtcggggttagatggagac
gaccaggttatggtggacttcctgttgcccactggaatctacatccagatggaagtccct
cgcgagagtaccatccaacacatcaaactgctattatggaaggaggcgcagacatatcct
ctcttctcattgctgggggagatggagggtcacatgttcgaatgcgtgaaccaggcagca
gtgcacgaggagctggaggatgagaccaggcgactatgtgatgtgcgaccattcctgcct
gttctcaaactgatcacacgtaattgtggacgtgcagagcgcctcctagattccaagatt
ggagttctcattggaaaaggtcttcatgagttggatgccctgcaagaccaggaagtaaaa
gactttcgttccaaaatgaaaagaatcagcgaagagaaaatgcagcaaatgcaaatgatg
tcatgggggcagtggcttcgcagctcttattccccacagctggacacaagctcattggat
aatttgattgagaggcatgagggcataattaaaatcaccatgcactacgaccagtcacag
gacacagccagcctgaaagtatcgttgaattgtacagtatctgaagtaatggatcatgct
ctcaagaaatggcagactactcatgggccagaggaagacattggtgcccgtagcaattat
gtgctgcgtgtcagtgatagacttgagttcctgtttgaagattatcctcttatacagtac
aaatacattagggcttgtttgtcgaccggtgaaaaccctcatctaacagtggttcacttt
gacatagtgaagagcatgtttgagaaggaaatcgctactgttggctcagtgcttgcaagg
aagacctcaaaccctccgctaccactgcccccaaagaagagacaaacaactgtaaggaca
tcgagtatgtctgcgtctcagttaccacaacaacttcatacatgtgtttggaaggttcat
tctctgtttagaattaatcttgtgaaagctaacaaggtgaacgctgaagatgctgctaag
atccaggttcgagcaggactttttcatggtacagagttgttgtgcaagacagctgtcagc
aatgagagcagcagtcgatctgaacatgtgtggaacaaaacactggagtttgacattcct
gtttgtgatctgccacggatggcccgcctctgctttgcaatttatgctgttatggataaa
gtgaaaaaacagagatccacaaagaacacacacctgaacaaataccagactatccgcaag
gcagggaaagtacactacccaattgcatgggtgaatactatggtatttgactacagaggg
cagctgaaaactggtgacattatcctccactgttggtcatcatttcctgatgagctggaa
gagatgttgaaccctatcggcaccattcagaccaatccatacacagagaatgccacagag
ctacatataagctttccagaatactcaacgcaaccagttgtttttcctgcttttgacaag
atcctggaaaaagctgcagaaatagctggagccagtgattccatgtcaatgggtcgtggg
ggtaaaaagttttacatagagctgaaggagatcatggagagggatcctctttctcagctg
tgtgagaatgagaaggatctgatctggacacttcgctatgactgcagagaaaattttcct
cagtctctccctaaacttctactctctgtcaaatggagcaaacatgaagacatggctcag
ctacaagctttgctgcagatttggcctaagctgagtcctcgtgatgctttggaacttctg
gacttcaactatccagaccagtatgtcagagaatttgcagtcagctgcctcaaagatatg
agtgatgatgagctgttgcagtatctgctgcagcttgtgcaggtgttgcgctatgagcca
tactatgactgcagcctcagccgtttcctcctagaacgtgctcagaccagccgtaaaatt
ggtcatttcctcttctggcatctcaggtctgaaatgtacatgccagctgtatcggttcat
tttgctctgatcttggaagcctactgcagaggctgcatcccacacattgaagttctcaaa
aaacaggttgaagctctcaataagctgaaagcagtaaatgagttgataaaactgggcact
ataaaaacgaagacaaagcaagctcatctgaaagaggccatgatgtcatgcctaagacag
acaggattcatcgagacactctccgatttgcattctcccctcaacccaaacatattgctt
gctggagtcagtgtggagaagtgcaagtacatggactctaagatgaaacctctgtggatc
gtttacaataacaagttgctgggaggagagacagtgggcatcatctttaaaaatggagat
gatctgaggcaagatatgttgactctacagattttaaagttgatggatctgctgtggaaa
gaggccaacctggacctcagaattgtgccttatggttgcttggcgacaggagatcattct
ggactcatcgaggtagtatcttcagctgacaccattgcgaacatccaaaaaacaagcagc
aacatggctgctgctgccgccttcaataaagacgctctgctaaactggcttaaagataaa
aactctggggatgctttggacaaagccattgaggagttcactctatcatgtgctggttat
tgtgttgccacctatgtcttgggcattggtgatcgccacagtgacaacataatggtccgc
agtacagggcagcttttccacatagattttgggcacatactgggaaactttaagtctaag
tttgggattaagcgggaacgtgttcctttcatcctcacacatgacttcatccacgtgatt
caagagggaaaaacaggcaacacagagaaatttggaaattttaggcaatattgtgaggag
gcatatatgattctgagaaagaatggaaatctgttcatcacactctttgctctcatgctc
accgcaggcctaccagagctcacgtctgtcaaagatatacagtatttaaaggactctctg
gcattaggcaaaactgatgaggaggccctcaaacagttccggcagaagtttgatgaagct
ctgcgagagagttggaccaccaaagtcaactggatggcccacattgtggctcacccttca
taa

KEGG   Danio rerio (zebrafish): 394174
Entry
394174            CDS       T01004                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    394174 (pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    394174 (pik3cd)
   04370 VEGF signaling pathway
    394174 (pik3cd)
   04068 FoxO signaling pathway
    394174 (pik3cd)
   04070 Phosphatidylinositol signaling system
    394174 (pik3cd)
   04150 mTOR signaling pathway
    394174 (pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    394174 (pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    394174 (pik3cd)
   04218 Cellular senescence
    394174 (pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    394174 (pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    394174 (pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    394174 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    394174 (pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    394174 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    394174 (pik3cd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    394174 (pik3cd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    394174 (pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    394174 (pik3cd)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     394174 (pik3cd)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    394174 (pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4037 RWD DIRP DUF4135
Other DBs
NCBI-GeneID: 394174
NCBI-ProteinID: NP_957493
ZFIN: ZDB-GENE-040426-1128
Ensembl: ENSDARG00000003250
UniProt: Q7SYE7
LinkDB
Position
23
AA seq 1039 aa
MPPGVYGMQEVWEMEGRQHVNIEFLLPTGIYLNFTVACSDTISTIKKMLWKNAKNEPLFS
ALSDPDAYVFTCINMTAEREELEDEQRRLCDVRPFLPILRLVAREGDRVEKLITTQINQL
IGKGHHEFDSQKNHELNEFRTKMRAFCEEHAYLRQTLPWDKWMEYNFPCDLEPCSSVTQS
GKSRSIKKIFVNVKFEGSEETFVLQQDPQDLPVVLKRNALRKKSTVFRSVKQEKPEDYSL
QVNERWEFIYGKYPLCQFKYIFTCLHGGLTPHLTMVHYSSIVKYQEEQSGLSNQVSRSRA
QSKPPPLPLKRQNTCSLWSIQEPFYIYLLQGSRVNADEGMKLVVQAGLFHGSELLCKVVT
SNEVSVCFDPVWDQKLVFDINVSDLPRMSRLCFALYGVIEKTKKRPTKKKNKRADCPLAW
VNTMVFDYKDQLKTGEFSLSTWPSVPDDKGDLLNPMGTVEKNPNIDSTAGLLIRFPNIRP
HPLYYPPIEKLNELGPNGEKVIATKEEHQKLKEIVDNKNSTEFFEDEKEPLWKLREELRL
KYPESLPKLLLITKWNKHEDVAQMVGLLQKWPELPALHALELLDYSFPDPHVRFFTIRCL
RKLPDDKLFQYLLQLVQVLKYESYLDCDLTSFLLERALANKKIGHFLFWHLRSEMHVPSV
SLRFGLILEAYCRGSIFHIKSLMKQNEALNKMKALNDFVKSASQKATRIQTTEDMKVCIK
QETYMEALSDVVSPLSPSIILCELCADKCKFMDSKMKPLWLMYKSKYDSVGIIFKNGDDL
RQDMLTLQMIQIMDILWKTEGLDLRMQPYGCLSTGNKTGLIEVVKNSDTIANIQRNNSNS
AATAAFNKDALLNWLKSKNPGDKLDQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRES
GQLFHIDFGHFLGNFKSKFGINRERVPFILTYDFVHVIQEGRTNNSEKFERFRVCCEQAY
KILCRNGTLFVNLFALMKAAGLPELNSSKDIQYLKDSLALGKSEEEALKNFKVKFNEALR
ESWKTKVNWMMHTFAKDNR
NT seq 3120 nt   +upstreamnt  +downstreamnt
atgccgccgggggtctacggcatgcaggaagtgtgggagatggagggtcggcaacatgtc
aacattgagttcctcctccccacggggatctacctcaattttactgtagcatgcagtgac
accattagtaccatcaagaagatgctgtggaagaacgccaagaacgagcctctgttcagt
gctcttagtgatccagatgcttacgtcttcacctgcatcaacatgaccgctgagcgggaa
gagctggaagacgagcagcgccgcctgtgcgatgttcggccattcctgccaattctcaga
cttgtggcccgggaaggagaccgagtcgagaagctcatcaccacccagatcaatcagctt
atagggaaaggtcatcatgaatttgactcccaaaagaaccacgagttaaacgaattccga
acaaaaatgcgggcattttgtgaagagcatgcctacttgcgtcagacgttaccgtgggac
aagtggatggagtacaacttcccatgtgacctggagccgtgctcttcagtaacccaatct
ggcaaatcacgcagcatcaagaagatctttgtcaatgtgaagtttgagggcagtgaggag
accttcgtcctccagcaagacccacaggacctgccggtggttctgaaacgcaatgctctg
agaaagaagtccactgttttcagatcggttaagcaggagaaaccagaggactacagcctg
caggttaacgagagatgggagttcatttatggaaaatatccactctgccagttcaaatac
attttcacatgtttgcacggaggtcttaccccacacctgacgatggtgcattattcatcc
atcgtcaagtaccaggaggagcagagtggcctcagtaaccaggtgtccagaagccgtgct
cagtccaaaccaccaccgctgcctctgaaaaggcaaaacacatgttcgctgtggtcgatt
caggagcctttctatatataccttctacagggaagtcgagtaaatgcagacgaaggcatg
aagctggtggtccaggcgggcctctttcacggcagtgaactcctgtgtaaagtggtgacc
agcaatgaagtcagtgtttgctttgaccccgtatgggaccagaagctagtgttcgacatc
aatgtgagcgacctgccccgtatgagccgcctctgcttcgccctctacggcgtcattgag
aagaccaagaagcggccaaccaaaaagaaaaacaaaagagcggattgtcctttggcctgg
gtgaacacgatggtgtttgactacaaagatcagctgaagacaggagaattctccctgtcc
acgtggccatcggtcccagacgataaaggcgatttgttgaatcctatgggcactgtggag
aaaaatccaaacatcgacagcacggctggcctcctaattcgctttcccaacatcaggcca
caccccttgtactatccaccaatcgaaaagctaaatgaactgggtcccaatggtgaaaag
gtcattgctacaaaagaagagcaccagaagctgaaagagattgtggacaataaaaactcc
accgagttctttgaggatgagaaggagccgttgtggaagctgcgagaggagctgagactg
aagtacccagagagcctccccaaactcctgctcatcacaaagtggaacaaacatgaggat
gtggctcagatggtcggtttgctacagaaatggccagaattgccagccctacacgctcta
gaacttctagactacagtttcccagaccctcatgtccgcttcttcaccatccgctgcctc
aggaagctgcccgatgataagctgtttcagtatctcttgcagctggttcaggttctaaaa
tacgaatcatacctggactgcgacttgaccagtttcctgctcgaacgagctctggccaac
aagaaaataggtcacttcttgttttggcacctcaggtcagaaatgcatgtaccctcagtc
agcttgagatttggactgattctggaggcctattgtcgtgggagcatctttcacatcaag
agcttgatgaaacagaacgaggctctaaataagatgaaggctctaaatgactttgtaaag
tcggccagtcagaaggcaaccaggatacagactaccgaggatatgaaagtgtgcataaaa
caggagacatacatggaagctctctccgatgttgtttcccctcttagcccaagcatcatt
ctgtgtgaactctgtgcagacaaatgcaagttcatggactcaaagatgaaacctctatgg
ctaatgtacaagagcaaatatgattccgtgggcattattttcaaaaacggagacgatctg
aggcaggacatgttaacccttcagatgattcagataatggatattctatggaaaacagaa
ggtcttgacctcagaatgcagccctatggatgcctttcaaccggcaataaaacaggtctc
atcgaggtggtcaaaaactcagacactatcgccaacatccagagaaacaacagcaacagt
gcagccactgctgccttcaacaaggacgctcttctcaactggctcaagtccaaaaaccca
ggggataaactggatcaagccattgaggaattcaccctttcgtgtgcaggctactgtgta
gctacatatgttctgggaataggtgatcggcacagtgacaatatcatgattagggaatct
gggcagttgttccatatagatttcgggcactttttggggaacttcaagagcaaattcggg
atcaacagggaacgtgtgcctttcattctgacatatgattttgttcatgtaattcaggag
ggacggaccaacaacagtgagaaattcgaaaggtttcgcgtctgttgtgaacaagcctat
aagattctttgccggaacgggactctttttgtgaatctttttgcattgatgaaagctgca
ggtcttccggagctcaattcttccaaagacatccagtatctaaaggactctttggcactg
gggaaatcggaggaggaagcactgaagaactttaaggtcaagtttaatgaagctctacga
gagagttggaagaccaaggtgaactggatgatgcacacatttgccaaagataacagataa

KEGG   Danio rerio (zebrafish): 404211
Entry
404211            CDS       T01004                                 

Gene name
pik3r2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    404211 (pik3r2)
   04370 VEGF signaling pathway
    404211 (pik3r2)
   04068 FoxO signaling pathway
    404211 (pik3r2)
   04070 Phosphatidylinositol signaling system
    404211 (pik3r2)
   04150 mTOR signaling pathway
    404211 (pik3r2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    404211 (pik3r2)
  09143 Cell growth and death
   04210 Apoptosis
    404211 (pik3r2)
   04218 Cellular senescence
    404211 (pik3r2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    404211 (pik3r2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    404211 (pik3r2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    404211 (pik3r2)
   04625 C-type lectin receptor signaling pathway
    404211 (pik3r2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    404211 (pik3r2)
   04914 Progesterone-mediated oocyte maturation
    404211 (pik3r2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    404211 (pik3r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    404211 (pik3r2)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    404211 (pik3r2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 V_ATPase_I
Other DBs
NCBI-GeneID: 404211
NCBI-ProteinID: NP_997987
ZFIN: ZDB-GENE-040309-1
Ensembl: ENSDARG00000018060
Vega: OTTDARG00000019733
UniProt: B3DHG9
LinkDB
Position
2
AA seq 724 aa
MAADGFQYRSIYSYRKDWEHDIDLEPGDILTVDKGSLLSLGIKEGDEQHPECIGWILGFN
ERTKQRGDFPGTYVQYVGPVKLSAPYCQPRSQRPLPAVPRPEPTASLQVVPDLDLTKQFM
HPETAPPNLIKLIEAVERSGLDCRTLYRTSASDNQRPSLSELQDLDVGQWDIHALSEAVI
RYLQDLPAPIIPPCVYTDLQAAVQLESDVPSVRRRELLQQVLDKPEVPLQNLLTLHYLLQ
HLDKVCQSAEQNGLDIYTLGQIFGPLLFRGPVSGSEEDEAFPAAAVERLLLERIWEQEPT
PPALPPKPPKAKAMASSVTNGSDSLLSEAEWYWGDISREEVNEKMRDTPDGTFLVRDASS
KVHGEYTLTLRKGGNNKLIKIFHRGGKYGFSEPLTFLSVVELINHYRHESLAQYNAKLDS
HLLFPVSKYQQDQVVKEDSIEAVGEQLKVYHEQYQEKSREYDVLYEEYTRSSQELQMKRT
AIEAFNETIKIFEEQCETQERLSRDSIEKFRREGNDKEIERIQSNSEKLKSRVTEIHDSK
RKLELDLKRQATDNREIDKLMNSLKPDLIQLRKLRDQYLVWLTQKGTRQRKINEWLGIKN
ESEDFYSLLDDDDDQAHHDECSWYVGDIKRSYAEDLLRGKRDGTFLIRESQTQKGSFACS
VVVEGEIKHCVVYKTATGFGFAEPYNLYGSLKDLVLHYKHTSLVQHNDSLNVTLAYPVLA
QQPR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggctgcggatggcttccagtacagatccatctactcctaccgtaaggactgggagcat
gacattgaccttgagcctggtgatatcctgacagtggacaaagggtctctgctgtcattg
ggcatcaaagagggcgacgagcagcaccccgaatgcatcggctggatcttgggctttaat
gagcgaaccaaacagaggggagactttccagggacatatgtgcagtatgtgggacctgtg
aaattgtcagcgccgtactgccagcctcgttctcagagaccacttcctgctgttcccaga
cctgagccaacagcctccttgcaggttgttccagacctagacttgaccaaacagttcatg
cacccggaaactgctccccctaatctgattaagctgatcgaagcagttgagcggtcaggt
ctggactgcaggacactgtacaggacttcagcctctgacaatcagcgaccgagcctcagc
gagctgcaggatctggacgtgggacagtgggacattcatgcgctttcggaggctgtgatt
cggtacctccaggaccttcctgcccccatcatccctccctgtgtttatacagaccttcag
gcagcagtgcagctcgaatcggacgtcccctccgtgaggagacgtgagctgcttcagcag
gtcctggacaagcctgaggttcctctgcagaacctgctgacactgcattatttgcttcaa
cacctggacaaggtctgtcagtccgctgagcagaacggcctcgacatttacaccctgggc
cagatcttcggccctctcctgttcaggggccctgtgagcgggtcagaggaagatgaggcg
tttcctgcagctgcagttgagagacttcttttggagagaatttgggaacaagagccgact
cctcccgctcttcctccaaaaccgcccaaagccaaagccatggcctcatctgtgactaat
ggaagcgacagcttactgagtgaagctgaatggtactggggagatatttcaagagaggaa
gtgaatgaaaaaatgagagacactcctgatggtacgttcttggtgcgggacgcttcaagc
aaagtgcacggagagtacactttgaccctcaggaaaggaggcaataacaaactgatcaag
atttttcatcgcgggggcaagtacggcttctctgagcctcttacttttctctctgtggtg
gagctcatcaaccactaccgccatgagtcactggcgcagtataacgccaagctggactct
cacctgctcttccccgtctccaaatatcagcaggatcaggtggtgaaagaggacagtata
gaggcagtgggagagcagctgaaggtttatcacgagcagtatcaggagaagagtcgtgaa
tatgacgtactgtacgaggaatacacacgctcatcacaagagttgcagatgaagcggact
gccattgaggcgttcaacgagaccatcaagatctttgaggagcagtgcgagacccaggag
cgcctcagtagagacagcattgagaagtttcgcagggaaggaaacgacaaggagattgag
agaattcagagtaactcggagaagctgaagtctagagtgacagagattcatgacagcaag
aggaagttggaactggatttgaagcggcaagctacagacaatcgagagatagacaagcta
atgaacagcttgaaaccagacctcattcagctgaggaagctaagggaccaatatcttgta
tggctgactcagaaaggcaccaggcaaaggaagatcaatgaatggctgggaataaagaat
gaatcagaggacttctattctctgctggacgacgatgacgatcaagcgcatcatgacgag
tgctcctggtacgttggagacatcaagcgctcgtatgcagaggatctcctgagaggcaaa
cgcgatggcaccttcctcatcagagagagccagacccagaagggctccttcgcctgctct
gtagttgtggaaggagaaatcaaacattgtgtggtttacaagacggccacaggtttcgga
tttgctgaaccctacaacctttacggctccttgaaagacttggtcctgcactacaaacac
acgtctctggtccagcacaacgactcgctgaatgtaaccctggcctacccggtgctcgca
cagcagcctagatga

KEGG   Danio rerio (zebrafish): 557176
Entry
557176            CDS       T01004                                 

Gene name
pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    557176 (pik3r1)
   04370 VEGF signaling pathway
    557176 (pik3r1)
   04068 FoxO signaling pathway
    557176 (pik3r1)
   04070 Phosphatidylinositol signaling system
    557176 (pik3r1)
   04150 mTOR signaling pathway
    557176 (pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    557176 (pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    557176 (pik3r1)
   04218 Cellular senescence
    557176 (pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    557176 (pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    557176 (pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    557176 (pik3r1)
   04625 C-type lectin receptor signaling pathway
    557176 (pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    557176 (pik3r1)
   04914 Progesterone-mediated oocyte maturation
    557176 (pik3r1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    557176 (pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    557176 (pik3r1)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    557176 (pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP AAA_13 SH3_1 SH3_2 SH3_9 Laminin_I Transcrip_act BRE1 Bap31_Bap29_C
Other DBs
NCBI-GeneID: 557176
NCBI-ProteinID: NP_001268773
ZFIN: ZDB-GENE-030131-1280
Ensembl: ENSDARG00000038524
Vega: OTTDARG00000018882
UniProt: B0S6V7
LinkDB
Position
5
AA seq 727 aa
MSAEGYQYRALYDYKKEREEDIDLHVGDILTVNKGALLALGYMEGMEERPDEVGWLPGFN
ETTQEKGDFPGTYVEFIGKKKISPPTPKPRPPRPLPVAPGPTRQDSDSEQSLSTLLDLTE
QFAPPEVAPSMLLKLLEAIEKKGLDNPTLYRNFTAGGGLDVRQCFDSDPASVDLEQMDLQ
MLCDGLRRYLQDLPQPVIPPVIYNEMIRIAQEVQGTDECAQHLRLVASSTALPPQYWLTL
QSLLRHFSHVCQSSAVNLLSARALAEIFSPALFRHQPTSCEPSPEAHIRIIEVLVTSEWS
DSQAAPALPPKPPKPTSVANNGMNNNMALQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRTESLAQYNPK
LDVKLLYPVSKHQQDQVVKEDNIEAVGKKLHEYHQQFQEKNREYDRLYEEYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFRREGNEKEIQRIMVNYEKLKSRISEIV
DSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
IKNENQDDQYSMVEDDEDLPHHDERSWKLGNINRIQAEALLRGKRDGTFLVRDSSKAGCY
ACSVVVDGEVKHCVINKTPTGYGFAEPYNLYNSLKELVLHYQHTSLVQHNDSLNVTLAYP
VYGHQRR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgagtgcagaaggatatcagtacagagcactgtatgactataagaaggagagggaggag
gatattgacctgcatgtaggggacattcttacagtcaataaaggtgcattacttgcactt
ggctacatggagggaatggaggagagaccagatgaagttggttggctgcctggctttaat
gaaaccacccaggaaaagggggactttcctggaacgtatgttgagttcatcggcaagaaa
aagatttctccaccaactcctaaaccgagacctccaaggcctctaccggttgccccaggg
cccacaagacaagactcggattctgagcaaagcttgagcactctgttagacctgactgag
cagtttgcccctccagaggtggcaccatctatgctgctgaagctccttgaggccattgag
aagaaaggtctagacaaccctacactctacagaaacttcactgctggaggagggctggat
gtcagacagtgctttgatagtgaccctgcctcggtggatcttgagcagatggaccttcag
atgttatgtgatggtcttaggaggtatctgcaagatttacctcagcctgtcatcccccct
gttatctacaatgagatgatacgcatcgctcaagaagttcaaggtacagatgaatgcgca
caacacttgaggctggtagccagctcaactgcacttcctccacagtactggctgaccctg
cagagcttgctgcgccatttctcccatgtttgccagtcctcagccgtcaacctgctcagt
gctcgcgcccttgctgagatctttagcccagcactcttcagacatcagcccacaagttgt
gagcccagtccagaggcacacatcaggataattgaagtactggtgactagcgaatggagt
gacagtcaggcagctccagcactacctcccaagccacccaaaccaacgtctgtcgctaac
aacggtatgaacaacaacatggctctgcaagatgctgaatggtactggggggacatctct
agggaggaagtaaacgaaaagcttagagacactgctgatggtacatttttggtccgagat
gcctccactaaaatgcatggggattacactcttacattgaggaaaggaggtaacaacaag
ctgatcaaaatctttcatcgcgatggcaagtacggcttctcagaccccctgaccttcaac
tctgtggttgagttgatcaaccactatcgaactgagtctctcgctcaatacaatcccaaa
ctagatgtgaaactactgtatcctgtgtccaagcaccagcaggatcaagtggtaaaagag
gacaacatcgaagctgtcggaaagaagttgcacgaataccaccagcagttccaagaaaag
aacagagaatatgaccgactctatgaggaatacactagaacatcacaggaaatacaaatg
aagaggactgctattgaagcttttaatgagaccattaagatctttgaagagcagtgccag
acgcaagaacgatacagcaaagaatatattgagaagtttagaagagaaggcaacgagaag
gaaatccaaaggatcatggtcaattatgagaagttaaaatctcgcatcagtgaaatagta
gacagtaaacgacgtctcgaagaagatctgaagaagcaggcagcagactacagagagatc
gacaagcggatgaacagcattaagcctgacctcatccagcttagaaagaccagggatcag
tacctcatgtggttgacacagaaaggagtcagacaaaagaaactcaacgaatggttggga
atcaaaaacgaaaaccaagacgatcagtactcaatggtggaggacgatgaggacttgcct
catcatgatgagcgctcctggaaactgggtaacatcaaccgcattcaagctgaggctctt
ctccggggcaagagagacggaacattcctggtcagggacagcagcaaagctggatgctat
gcctgcagtgttgttgtggatggtgaggtcaagcactgcgtcatcaacaagacaccgaca
ggatatggcttcgctgagccctacaacctttataactctctgaaagaactggtattgcac
taccagcacacgtccctggttcagcacaatgactctttgaatgtcacgttagcataccca
gtctacggacaccagaggcggtga

KEGG   Danio rerio (zebrafish): 561737
Entry
561737            CDS       T01004                                 

Gene name
pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    561737 (pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    561737 (pik3ca)
   04370 VEGF signaling pathway
    561737 (pik3ca)
   04068 FoxO signaling pathway
    561737 (pik3ca)
   04070 Phosphatidylinositol signaling system
    561737 (pik3ca)
   04150 mTOR signaling pathway
    561737 (pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    561737 (pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    561737 (pik3ca)
   04218 Cellular senescence
    561737 (pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    561737 (pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    561737 (pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    561737 (pik3ca)
   04625 C-type lectin receptor signaling pathway
    561737 (pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    561737 (pik3ca)
   04914 Progesterone-mediated oocyte maturation
    561737 (pik3ca)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    561737 (pik3ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    561737 (pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    561737 (pik3ca)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     561737 (pik3ca)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    561737 (pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 C2 Ribosomal_S15
Other DBs
NCBI-GeneID: 561737
NCBI-ProteinID: XP_009304451
ZFIN: ZDB-GENE-130409-1
Ensembl: ENSDARG00000075456
Vega: OTTDARG00000035776
UniProt: F1QAD7
LinkDB
Position
11
AA seq 1069 aa
MPPRPSSGELWGIHLMPPRILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKDSVELRDASGAHSRALYVYPPNVESSPELPKH
IYGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSAEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPISQYKYVRSCIMLGRLPNLMLMSKDSLYSQLPMD
NFTMPSYSRRISTATPYMNGEASTKSLWTINSTLRIRVLCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNVNLFDYTHTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDYF
SSPVKFPDMATIEDHANWIISREMGYNYCQSGQSSRVARDHAMTEADIEQLRQLGNRDPL
SEITEQEKDFLWRHRQYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDYMDALQNFTSPLNPAHQLGNLRLEDCRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSTTLHQWLKDKNKGEMYDMAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDI
AYIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRHHAQN
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgcctccaagaccctcttcgggagagttatggggcatccatttgatgccccccaggatt
ttggtggactgtctgctgcccaatggcatgatcctgacactagagtgcctccgggaggct
acgctcataacaatcaaacatgaactgtttaaggaggctaggaaataccccctacaccat
ctgctgcaggaggagacctcttatattttcgtcagtgtaacgcaagaggcagagcgagag
gagttctacgatgagaccagaagactctgcgaccttcggcttttccagccattcctaaaa
gttatcgaacctgtagggaacagagaggaaaagatcctcaacagagaaattggttttgcc
attggcatgccagtgtgtgagtttgatctagtgaaggatcctgaggtgcaggacttcagg
agaaatatccttaatgtctgcaaggactcagtagagttgcgggacgccagcggggcacac
agtcgagcactatacgtttatcctcctaacgtggagtcttcaccagagcttccaaagcat
atatatggcaaattagacaaaggtcaaatcattgtggtcatctgggtgatcgtctcgccc
aacaacgacaagcagaagtacacactaaagatcaatcacgactgcgtacctgagcaggtg
atcgccgaagccatcaggaagaaaaccagaagcatgctgctgtcagccgagcagctaaag
atgtgcgtgcaggaatatcagggcaaatacatcctgaaggtctgcggctgtgacgagtat
cttttggaaaagtaccccatcagtcagtacaagtatgtacggagttgcattatgctgggt
cgcttgccaaacctcatgcttatgtccaaggacagtctttactctcagctgccgatggac
aacttcaccatgccctcctattcccgccgcatctccaccgccacgccttacatgaacgga
gaggcctccaccaaatctctctggaccattaacagcacccttaggatacgggtcctctgc
gcaacatacgttaatgtgaacattcgggacattgataagatttatgtgcggacggggatc
taccatggtggagaacagttgtgtgataatgtcaacacgcagcgtgtcccgtgttcaaat
ccgaggtggaacgagtggctgacttatgacatgtacattcctgacatcccccgggcggct
cgtctctgtctctccatctgttctgtgaaaggaaggaagggggcaaaagaggagcactgt
ccactggcctggggaaacgtcaacctgttcgactacacacacactctggtctcaggaaag
atggcactgaatctgtggcctgtaccacacggcctagaagacctgcttaaccccatcggt
gtcacaggctccaaccctaacaaggaaaccccatgtttagagctggagtttgactatttc
agctcacctgttaagttccctgacatggctacaattgaggatcacgctaactggataata
tccagagagatgggatacaattactgccagtctggacagagcagtagagtggcacgagac
catgcaatgacagaggcagatatagagcaacttcggcagctgggaaacagggacccgctt
tctgagatcactgagcaggaaaaagacttcctatggaggcacaggcagtattgtgtaaat
ataccagaaatcctgcccaagattctgctggcggtgaagtggaattccagagatgaagtt
gcacagatgtattgccttctgaaagattggcctgcaataaagccggaacaagccatggag
ttgcttgactgtaactaccctgatccaatgatccgagactttgcggttcggtgccttgag
aagtatctaaccgatgacaaactctcgcagtacctcattcaattggttcaggttttgaag
tacgagcagtatcttgataacccactggtgcgatttctgctaaaaaaagctctcaccaac
cagaggattgggcacttcttcttttggcatttgaagtcagagatgcacaataaaactgtg
agtcagcggtttggcctactgctggagtcgtactgccgcgcgtgtggcatgtacctgaag
cacctgagcagacaagtggaggccatggagaagctcatcaacctcacagacattctcaaa
caggagaagaaggatgaaactcagaaggtgcaaatgaagtttctagtggagcagatgagg
cgaccagactacatggatgccctccaaaatttcacctctccactaaaccctgcccaccag
ctggggaacctacgacttgaagactgcagaatcatgtcctctgccaagagaccgctctgg
ctgaactgggaaaatcctgacatcatgtccgaacttctcttccaaaacaatgagatcatc
ttcaagaacggagatgatctgcggcaagacatgttgacgcttcagatcatcagaataatg
gagaacatttggcaaaatcagggtctggacctgagaatgctcccctatggctgcttgtct
attggagattgtgtgggtctcatcgaggtggtaagaagttctcacaccatcatgcagatt
caatgtaaaggaggcctgaagggtgcgctgcagtttaacagtacaacgctgcatcagtgg
ctaaaagacaagaacaagggtgaaatgtacgacatggctatagacttgtttacgcgatcc
tgtgctggctattgtgtggccactttcattctgggtattggtgacaggcacaacagtaac
atcatggtgaaggatgatgggcagctgtttcatatagattttggtcactttttggaccac
aagaagaagaagtttggctacaagcgagagcgagtgccgttcgtcttgactcaagacttc
ctaattgtgatcagcaaaggaggaacccaggagtgcactaaaaccagagagtttgagagg
tttcaagagatgtgctacaaggcatacctggccatccgacagcatgccaacctcttcatc
aacctcttctccatgatgctgggctcaggaatgccggagctgcagtccttcgacgacatc
gcttacatccgcaagactctggcattagacaaaaccgagcaggaagccctggactatttc
atgaagcagatgaatgacgctcaccatggcggatggaccaccaagatggactggatcttc
cacaccatccgtcaccatgcccaaaactga

DBGET integrated database retrieval system