KEGG   Danio rerio (zebrafish): 100000720
Entry
100000720         CDS       T01004                                 

Gene name
abl1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100000720 (abl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100000720 (abl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100000720 (abl1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100000720 (abl1)
Protein kinases [BR:dre01001]
 Non-receptor tyrosine kinases
  ABL family
   100000720 (abl1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 100000720
NCBI-ProteinID: XP_005172104
ZFIN: ZDB-GENE-100812-9
Ensembl: ENSDARG00000035187
Vega: OTTDARG00000034046
UniProt: F8W2F9
LinkDB
Position
5
AA seq 1081 aa
MGQQPGKLVGEQRRPSLPALPFIKAAGRRETPRHGAPHCNVFTVHESRPDFDPPGLSEAA
RWNSKENLLSGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKN
GQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLR
YEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVSDGLITTLHYPAPKRNKPTIY
GVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKE
AAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTHGNLLDYLRECNRQEVNAVVLLYMATQ
ISSAMEYLEKKNFIHRDLAARNCLVGENNLVKVADFGLSRLMTGDTYTAHAGAKFPIKWT
APESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMDRPEGCPE
KVYELMRACWRWNPAERPSFAETHQAFETMFQESSISDEVEKELGKKGKKLTLGPIQQAP
ELPTKTRTLRRPTDGRDGDSPDAAEAEVTGPPMMPRPLLDSNLNEDDRLQSKDNKDKFRM
NPFSYIKKKKRTAPAPPKRSSSFGKMDGHLDRRGLGTDCREDFSNGSSTNDALNSIDPCK
LVGSNSTTTIGVTNGAPVYPGQLFPSHPRKKGTTSGGGGKLATTPPPEEDSMSNSKRFLR
SSSSSSMPPGSDRFEWKSVTLPRDIQSTHFDSNTFRGKPALPRKSCMPRGGTLTPPPRLP
KKSEDVSDEVFKDSESSPGSSPLTLTPKLGRRPQTESSKTSALQTEVLKPNVLPPLGDEG
RPRRLKLSSEIPGQREREKGKFAKPKPAPPPPPVSSAKSGKTSRSPTFEVSSDTKVKSSL
DSADQGKASLSQESAKKLPKNGSKVNPSKAGATAPLPGMGASPVVGDPGSSFIPLMTTRR
SLRKAPARQPSERLSSSTITRDMLLESSELLRTAIARVSEQTGSHSAVLEAGKNLSKYCV
SYVESIQQMRNKFAFREAINKLESSLRELQICPAATGTANTPQDFSKLLCSVKEISDIVQ
R
NT seq 3246 nt   +upstreamnt  +downstreamnt
atggggcagcagccaggaaagttagtgggtgagcagaggagaccgagcctgccggcactg
cccttcatcaaggccgcggggaggagagagacgccccggcacggagcaccgcactgcaat
gtgttcacggtccacgagtctcggccggatttcgatccccccggtctttcagaagcggcg
cgctggaactctaaagagaacctgctgtcgggacccagcgaaaatgaccccaatctgttc
gtggcgctgtacgactttgtggcgagcggcgacaacactctcagcataactaaaggagag
aagctgagggttctgggatacaatcacaatggtgagtggtgcgaggcgcagaccaagaac
gggcagggctgggtgcccagcaactacatcacgcccgtcaacagcctggagaagcacagc
tggtaccacgggccggtgtccagaaatgctgcagagtacctgctgagcagcggcatcaac
ggcagcttcctggtgcgggagagcgagagcagcccgggacagcgctccatatcactgcgc
tacgagggacgagtctaccactaccgcattaatacagcctcagacggcaagctgtacgtg
tcgtccgagagccgctttaacactctagcagagctggttcatcatcactccacggtctct
gacggtctgatcaccacgctgcattaccccgcacccaaacgcaacaaacccaccatctac
ggcgtctctccaaactacgacaagtgggagatggagcgcacggacatcaccatgaagcac
aagctgggcggagggcagtacggggaggtgtacgagggcgtgtggaagaagtacagcctc
accgtggcggtgaaaacactgaaggaagacaccatggaagtggaggagtttctgaaagaa
gctgcagtgatgaaagaaatcaaacacccaaacctggtgcagctcttaggcgtctgcact
cgggaacctccgttctacatcatcactgagttcatgacacatggaaacctgctggattac
ctgcgcgagtgtaaccggcaggaggtgaacgctgtggtgctgctctacatggccacgcag
atctcctccgccatggagtacctggagaagaagaacttcatccacagggatctggcagcc
cgtaactgcttggtcggggaaaacaacctggttaaagtggcagattttgggctaagccgg
ctgatgacgggagacacatacacagcccacgctggagcaaagttccccattaaatggact
gcgccggagagtctggcctataacaagttctccatcaagtcagacgtgtgggcatttgga
gtcctgctttgggagatcgccacctatgggatgtctccgtatccaggaatcgacctgtct
caggtgtatgagctgctggagaaagactaccgcatggacagacccgagggatgcccagag
aaagtctatgagctcatgagggcctgttggaggtggaaccctgccgagcgcccttctttt
gctgagacccatcaggcgttcgagaccatgtttcaagagtccagtatctctgatgaggtg
gagaaagagttggggaaaaaaggaaagaagctgaccctgggaccaatacagcaggcgcca
gaacttccaactaaaaccaggacactacgaagacctacagacggcagggatggggacagt
cccgacgcagccgaggccgaggtcactggacccccgatgatgccgaggccactcctagat
agcaacctgaatgaagatgatcggctccagtctaaagataataaggataaatttcgaatg
aatcccttcagttatattaagaaaaagaagaggacggctccggcgcccccaaagcgcagc
agctcctttgggaagatggacggacacctagaccgtagaggattgggtactgactgcagg
gaggatttcagcaacgggtcttccaccaatgatgccttaaacagcattgacccttgcaaa
ttagttgggtcaaacagtaccacgaccatcggggtcaccaacggagctccagtgtatccc
ggtcagctcttcccatctcatccacggaaaaagggcactacatcgggtggtggagggaag
cttgccacgactccacctccagaggaggactccatgtcaaactccaaacgcttcctacga
tcttcttcttcctccagcatgcctccaggctctgatcgcttcgaatggaagtccgtaacc
ctgccgcgggacattcagtcaacacactttgattctaacacattcagaggcaagccagct
ttacctcgtaagagctgcatgccacgaggtggcacgcttaccccaccaccacgccttccc
aagaaaagtgaagatgtttcagacgaagtcttcaaggactctgagtctagtcctggatca
agtcctttaactctgactcccaagctaggccgccgaccccaaacagaaagctccaaaact
agtgccttacaaacagaggtattaaaacccaatgtgcttccacctcttggagacgaaggc
agacctcgaagactcaaactgtcctctgaaatcccaggacagagagagcgggagaagggg
aagtttgcgaaacccaaacccgctccccctcctcctccggtgtccagtgccaaatctgga
aagacctcaaggagtccgacttttgaggtgtcttcagataccaaagtcaagagttcacta
gactccgcagatcaaggcaaggctagtctatcccaagaaagtgctaaaaagttgcccaaa
aatggctcaaaggtaaacccctcgaaggcaggtgcgactgctcctctacctggaatggga
gccagtcctgtggtcggggatccgggatccagcttcatcccactgatgacgacgcgacgt
tcactgaggaaggctccagcacggcagccatcagagcgactctccagctccaccatcact
cgagacatgctgttggagagctctgagctcctgcgtaccgccattgcacgtgtctccgag
cagaccggcagccacagcgctgtcctggaggcggggaaaaatctgtccaagtactgcgtc
agctacgtggagtccatccagcagatgcggaacaagtttgctttccgcgaagccatcaat
aagctggagagcagcctgcgcgagctgcagatctgccccgcggccaccggcaccgcaaac
actccgcaggacttctcaaagctgctgtgctccgtcaaggagatcagcgacatcgtgcag
aggtag

KEGG   Danio rerio (zebrafish): 570636
Entry
570636            CDS       T01004                                 

Gene name
abl2
Definition
(RefSeq) tyrosine-protein kinase ABL2
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    570636 (abl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    570636 (abl2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     570636 (abl2)
Protein kinases [BR:dre01001]
 Non-receptor tyrosine kinases
  ABL family
   570636 (abl2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6 PARP_reg
Other DBs
NCBI-GeneID: 570636
NCBI-ProteinID: NP_001116177
ZFIN: ZDB-GENE-020809-2
Ensembl: ENSDARG00000013841
Vega: OTTDARG00000026649
UniProt: B0UXN7
LinkDB
Position
8
AA seq 1135 aa
MTLRTLPSSSSFEEEWVRLTKLPSTQDDHYCLAEALHRPFGLDSTALTEAVRWSSKENLL
GAAESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYI
TPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRI
NTASDGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWE
MERTDITMKHKLGGGQYGEVYVGVWKKYNLTVAVKTLKEDTMEVEEFLKEASVMKEVKHP
NLVQLLGVCTLEPPFYIVTEYMPHGNLLDYLRECERDQVNAVVLLYMATQISSAMEYLEK
KNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTF
SIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACW
QWSPLDRPSFAEIHQAFETMFHDSSISEEVAEELCKTASGGQSGVAHTFGPDMPLLPSKS
RGQKKHSENKENMEEAGPHGPAGLATSLFVGDGRSSSSPALPRKQRDKSPSSLLEDCQDT
TFTRDRKAGFFSSFMKKKSMSSSSATSSPQQQQNLPMPPKRSSSFREMETQPHKKYEPTA
GFSGPPPPLPQTDGLSFSPSHGEGNHVQSRCCGATFGQKPSSSNSGATSGQVGSSSSWGS
LAGFFTPRLIKKTLGLRTGKSSGIDEVSGAKPFPRSNSTSSMSAGLPDLERMALTLPRNR
SKPPLERTSSTTSQPENGATRPSDAILRKLDEGTAQIRDRPKAKLLPRGVAGGVRAPGVG
GEAESDSNTRGKDGQDDRQGWSSPSKTSTLGSVNLHNHKVPVLISPTLKHSSGDAHLVGV
DSQGNRFKLLSDSGDRDRPRLVKPKCAPPPPPMLRSLQHAYSADAADEVVSGNMEVNGDT
IKRSGREVRGARPSIPPPQVPPAPVVPSSNNTTQTKLANGASSGGPGPTSAKPTLRRTRQ
QTERIPLEKISKEALLECAECLSSALQGNSELSSSSQVLDVGHQLLDYCSGYVDCIPQTR
NKFAFREAVGKLELSLQELRACSTGGGVGLSGPGTSPALDNLHMCIKEISDVVQR
NT seq 3408 nt   +upstreamnt  +downstreamnt
atgacattgaggacccttccgtccagcagcagttttgaggaagagtgggtcaggctgacc
aaactacccagcacacaggatgaccactattgcctcgcagaagccctgcacaggccgttt
ggactggactcgacggcgctgacggaggcggtgcgctggagctccaaggagaatctgctg
ggtgctgctgaaagtgaccccaacctttttgtggcactttacgactttgttgccagtggt
gacaacacactaagcatcacgaaaggagagaagctgcgagtgttgggttataaccagaat
ggagaatggagtgaagtccgctcaaagaacggccagggctgggtacccagtaactacatc
acccccgtaaacagtctggagaagcacagctggtaccatgggcccgtgtcccgcagcgct
gccgagtacctgctcagtagcttgatcaacggcagcttcctggtgcgggaaagcgagagc
agccccggccagctctccatctctcttcgctatgagggacgggtctatcattaccgcatc
aacacggcctctgatggaaaggtctatgtgacagcagagagtcgtttcagcacgttagct
gagctggttcatcatcattccacagttgcggatggactggtaaccactctgcattatcct
gctcccaaatgcaacaagcccaccgtctacggcgtctctcccatccacgacaagtgggag
atggagcgcaccgacatcaccatgaagcacaaattgggtggaggacagtacggagaggtg
tacgttggagtttggaaaaagtacaacctcactgtagctgtaaaaacactaaaggaggac
accatggaggttgaggagtttcttaaggaggcctcagtcatgaaggaggtcaaacatccc
aatctagtacagttactgggtgtgtgtactttggagcctcccttctacattgtgaccgag
tacatgccccatgggaacctgctggattacctgcgtgagtgtgaaagggaccaggtgaat
gctgtggtgctgctctacatggccactcagatctcctccgccatggagtatctggagaag
aagaacttcatccatagggacctggcagctcgtaattgtctagtaggagagaatcacgtg
gtgaaggtggctgatttcggactgagccgtctgatgacgggtgacacctacacagctcat
gcgggagccaaattccccatcaaatggaccgcaccagagagtctggcctacaacaccttc
tccatcaaatcagatgtgtgggcatttggagttttgctttgggagattgcgacgtacggc
atgtctccatatccaggaattgacctgtctcaggtatatgatctgctggagaagggctac
cgcatggagcagcccgaaggctgtcctcctaaagtctacgagctcatgagagcctgctgg
cagtggagtccactggatagaccctcatttgctgagattcatcaggcctttgaaaccatg
tttcatgactcaagcatttcagaagaggtagctgaagagctgtgtaaaactgcgtctggt
gggcagagtggagttgcccacaccttcggccctgatatgccactcttgccctcaaagtct
cgtgggcagaagaaacactcagagaacaaagagaatatggaggaggcaggaccccacggc
cctgcaggtcttgcaacatccctttttgttggtgatggccgctctagcagctctccagcc
ttgcctcgtaaacagcgggataagtctccctctagcctgctggaggactgccaggacacc
accttcacccgtgatcggaaggctggcttcttcagttcattcatgaagaagaagtccatg
tcctcctcttctgctacatcctcacctcagcagcagcagaacctcccaatgcctcccaag
aggagcagctctttcagggagatggagacccagccccataaaaagtatgagcccacggct
gggttttcaggtcctcctcctcctctgcctcagactgatggattgagtttctctccatct
cacggagagggaaatcatgtgcagtcccgctgttgtggggccacatttgggcaaaagcct
tcaagttcaaactctggagcaacttctggtcaagtgggaagcagcagtagctggggaagc
ctagcgggctttttcacccctcgccttattaaaaaaactctaggattgcggactggtaag
tcttctggaatagacgaagtgagtggagccaagccattccctcgctccaactcaacatcc
tctatgtctgctgggttgccagatttagaacgcatggcattgacgttaccaagaaaccgt
agcaaacctccactagaacgcacatcttctaccacctcacaaccggaaaatggggcaaca
cgaccttcagatgcaatcctgagaaagcttgacgaaggtacagctcagatacgggatcgt
cccaaagccaaactcttgccacgaggggtcgcaggtggagttagggcaccaggtgtaggg
ggagaggcagaatcggactcaaacacaagggggaaagatgggcaagatgacaggcaaggc
tggtcatctccatccaaaacctctacccttggttctgtcaatctgcataaccacaaagtt
ccagtgctgatctccccgactttaaagcacagctcgggtgatgcacacctagtcggcgtg
gactctcagggcaaccgcttcaaactactgtccgatagtggggatcgtgaccgaccacgt
ctggtgaagccaaaatgtgcacctcccccaccgcccatgctacgctccctccaacacgcc
tacagtgccgatgcagctgacgaagtggtcagtgggaacatggaggtcaatggagatacc
atcaaaaggtcgggaagagaagtcaggggagcacgtccgtcaataccaccaccacaagtg
cctccagcccctgtagttccctcgagtaacaacaccacccaaaccaagttggctaatggt
gcttcaagtggcggaccaggccctacttcagctaaacccactcttagacggactcggcag
cagacagaaaggatccctcttgagaagatcagtaaggaagctcttctggaatgtgctgaa
tgtttgagtagtgctcttcaaggtaactccgagctttcgtccagcagccaggtcctggat
gtgggacaccaacttttggactactgctcggggtatgttgattgcatcccacagacacgt
aataagtttgcctttcgagaggctgtagggaaactggagttgagtctacaggagctgcgc
gcttgctctacgggtgggggagtgggacttagtggacctgggaccagcccagctcttgac
aacttgcacatgtgcattaaagagatcagtgatgttgttcaaaggtag

DBGET integrated database retrieval system