KEGG   Danio rerio (zebrafish): 100002225
Entry
100002225         CDS       T01004                                 

Gene name
map2k2b
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2b
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04270  Vascular smooth muscle contraction
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04620  Toll-like receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100002225 (map2k2b)
   04012 ErbB signaling pathway
    100002225 (map2k2b)
   04370 VEGF signaling pathway
    100002225 (map2k2b)
   04371 Apelin signaling pathway
    100002225 (map2k2b)
   04068 FoxO signaling pathway
    100002225 (map2k2b)
   04150 mTOR signaling pathway
    100002225 (map2k2b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100002225 (map2k2b)
  09143 Cell growth and death
   04210 Apoptosis
    100002225 (map2k2b)
   04218 Cellular senescence
    100002225 (map2k2b)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100002225 (map2k2b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100002225 (map2k2b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100002225 (map2k2b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100002225 (map2k2b)
   04912 GnRH signaling pathway
    100002225 (map2k2b)
   04916 Melanogenesis
    100002225 (map2k2b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100002225 (map2k2b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100002225 (map2k2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100002225 (map2k2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100002225 (map2k2b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE7 family
   100002225 (map2k2b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7
Other DBs
NCBI-GeneID: 100002225
NCBI-ProteinID: NP_001121753
ZFIN: ZDB-GENE-080219-34
Ensembl: ENSDARG00000068918
Vega: OTTDARG00000034734
UniProt: A9JRF0
LinkDB
Position
2
AA seq 395 aa
MAPKKRPDPIVITGSGEAQTTSTPIDAASEANLEALQKKLDELDLDEQQKKRLEAFLTQK
ANLGELKDDDFQHICELGAGNGGVVNKVCHKPSGLVMARKLIHLEIKPAIRHQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMENMDGGSLDQVLKEARRIPEEILGKVSIAVLRGL
AYLREKHQIIHRDVKPSNILVNCRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEGIFGRALMDVGEAETHSTSPRPRPP
GRPISGHGPVMAIFELLDYIVNEPPPKLPHGVFTPDFQDFVTNCLIKNPADRADLKMLMN
HTFIKRAEVEEMDFAGWLCKTMGLNQPSTPTQTTE
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggctcccaaaaagaggccagatcctatagttataactggaagcggagaagcacagacg
acctccacgcccatagatgctgcatcagaagcgaatcttgaagccctgcagaagaagctg
gatgagctggatttggacgagcagcagaagaagcgtctggaagctttcctcacgcagaaa
gccaatctgggagagctgaaggacgatgatttccagcatatctgtgaactgggagctgga
aacggaggagtggtgaataaagtgtgccacaaaccttcaggtctcgtcatggcccggaag
ttaattcacctggagatcaagccggccatcaggcatcagatcatcagagagctgcaggtc
ttgcatgagtgtaattcaccatacatcgtgggtttttacggcgcattttacagcgatggc
gagattagtatctgtatggagaacatggacggcggatcgttggatcaggtcctgaaagag
gctcgcagaatcccagaggagattttgggaaaagtcagcatagctgttttaagaggtctc
gcttaccttcgagaaaagcaccagattattcacagagatgtgaaaccctcaaatattctg
gtaaactgtcgcggggagatcaagctgtgtgacttcggtgtgagcgggcagctgatcgac
tccatggccaactcttttgtaggaacacgctcatacatgtcgccggagcggttgcagggc
acacattactcagttcagtcagacgtgtggagtatgggtctctctctggtggagctcgcc
atcggccgataccctattcctccacctgacgccaaggagctggagggcatcttcggcagg
gcactgatggatgttggagaggcagaaacacacagcacgtctcctcgacccagaccacct
ggcagacccatcagcggtcatgggccggtcatggctatatttgagctgctggattatata
gtcaatgagcctcctcctaaactgcctcacggcgtcttcactcctgatttccaggacttt
gtgaccaactgtcttattaaaaaccctgcagacagagcggacctgaagatgctgatgaat
cacacatttatcaaacgcgccgaagtggaggagatggactttgctggatggttgtgtaaa
acaatgggtctcaatcagcccagcacacccacacaaacaactgaatga

KEGG   Danio rerio (zebrafish): 406728
Entry
406728            CDS       T01004                                 

Gene name
map2k1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04114  Oocyte meiosis
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04270  Vascular smooth muscle contraction
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04620  Toll-like receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    406728 (map2k1)
   04012 ErbB signaling pathway
    406728 (map2k1)
   04370 VEGF signaling pathway
    406728 (map2k1)
   04371 Apelin signaling pathway
    406728 (map2k1)
   04068 FoxO signaling pathway
    406728 (map2k1)
   04150 mTOR signaling pathway
    406728 (map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    406728 (map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    406728 (map2k1)
   04210 Apoptosis
    406728 (map2k1)
   04218 Cellular senescence
    406728 (map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    406728 (map2k1)
   04540 Gap junction
    406728 (map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    406728 (map2k1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    406728 (map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    406728 (map2k1)
   04912 GnRH signaling pathway
    406728 (map2k1)
   04914 Progesterone-mediated oocyte maturation
    406728 (map2k1)
   04916 Melanogenesis
    406728 (map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    406728 (map2k1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    406728 (map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    406728 (map2k1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     406728 (map2k1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE7 family
   406728 (map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Seadorna_VP7 Kdo Kinase-like CAMSAP_CC1 NAD_binding_6
Other DBs
NCBI-GeneID: 406728
NCBI-ProteinID: NP_998584
ZFIN: ZDB-GENE-040426-2759
Ensembl: ENSDARG00000007825
Vega: OTTDARG00000023382
UniProt: Q4V947
LinkDB
Position
18
AA seq 395 aa
MQKRRKPEPIQLNPIPDGNAINGTGATETNLEALQKKLEELELDEQQKKRLEAFLTQKQK
VGELKDDDFEKISELGAGNGGVVFKVLHRPSGFIMARKLIHLEIKPAIRNQIIRELQVLH
ECNSPYIVGFYGAFYSDGEISICMENMDGGSLDQCLKKAGKIPEQILGKVSIAVIKGLSY
LREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH
YSVQPDIWSMGLSLVEMAIGRFPIPPPDAKELEQIFGQPLEGDPSASDTSPKPRPPGRPG
SSYGPDSRPPMAIFELLDYIVNEPPPKLPSIFGAEFQDFVNKCLIKNPAERADLKQLMVH
SFIKDSEAEEVDFAGWLCSTIGLNQPATPTHSVGM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcagaaaaggaggaagccagagccgatccaactgaacccaattccagatgggaacgct
atcaacggcaccggggccacagaaacaaatctggaagctctgcagaagaagctggaggaa
ctggagctggacgagcagcagaaaaaacgcctggaagctttcctcacccaaaagcagaag
gtcggagagttaaaagacgatgacttcgagaagatcagcgagttgggagcaggcaatgga
ggagttgtgtttaaagtcttacacaggccgtcaggcttcatcatggccaggaagttgatc
caccttgagattaagccagcaataaggaatcagatcatcagagagctgcaggtgctgcat
gaatgtaactctccctacatcgtgggcttctatggggctttctacagcgacggagagatc
agcatctgtatggagaacatggatggcggctctttggaccagtgccttaagaaagcaggc
aagatcccagaacaaatactgggcaaagttagcattgcggtgattaaaggtctgtcatac
ctgcgggagaaacacaagatcatgcacagagatgtaaagccatctaacatcttggtcaac
tcgcgtggggagatcaagttgtgtgactttggtgtgagtggacaactcattgactccatg
gccaattccttcgtgggaaccaggtcctacatgtctcccgaacgccttcaaggcactcac
tactctgtccagcctgacatatggagcatgggtctctctctggtggagatggccatcgga
cgcttcccgatcccaccacctgatgccaaagagctggaacaaatcttcggtcagcccctg
gagggagacccatcagccagtgacacttctccaaaacccaggccccctggtcgacctggc
agctcatacggtccagacagcagacctcccatggctatatttgagctacttgattatatt
gtcaatgaaccacctccaaagctaccaagtatctttggtgcagaatttcaagactttgta
aacaaatgtttaatcaaaaatccagcagaaagagcagacctcaagcagctgatggttcat
tcgtttatcaaggactcagaggctgaggaggttgacttcgctggatggttgtgcagcacc
attggactgaaccagccagcaactccgactcacagtgtgggaatgtga

KEGG   Danio rerio (zebrafish): 563181
Entry
563181            CDS       T01004                                 

Gene name
map2k2a
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2a
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04270  Vascular smooth muscle contraction
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04620  Toll-like receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    563181 (map2k2a)
   04012 ErbB signaling pathway
    563181 (map2k2a)
   04370 VEGF signaling pathway
    563181 (map2k2a)
   04371 Apelin signaling pathway
    563181 (map2k2a)
   04068 FoxO signaling pathway
    563181 (map2k2a)
   04150 mTOR signaling pathway
    563181 (map2k2a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    563181 (map2k2a)
  09143 Cell growth and death
   04210 Apoptosis
    563181 (map2k2a)
   04218 Cellular senescence
    563181 (map2k2a)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    563181 (map2k2a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    563181 (map2k2a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    563181 (map2k2a)
  09152 Endocrine system
   04910 Insulin signaling pathway
    563181 (map2k2a)
   04912 GnRH signaling pathway
    563181 (map2k2a)
   04916 Melanogenesis
    563181 (map2k2a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    563181 (map2k2a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    563181 (map2k2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    563181 (map2k2a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     563181 (map2k2a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE7 family
   563181 (map2k2a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 563181
NCBI-ProteinID: NP_001032468
ZFIN: ZDB-GENE-041027-1
Ensembl: ENSDARG00000006609
Vega: OTTDARG00000010261
UniProt: Q1LY62
LinkDB
Position
22
AA seq 397 aa
MAPKRRPVPLIITPTGEGQSTNIDAAAEANLEALQRKLGELDLDEQQRKRLEAFLTQKAQ
VGELKDEDFEPICELGAGNGGVVHKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQVLH
ECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGLAY
LREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH
YSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVLDAGGAEGHSMSPRPRPPGR
PVSGHGMDSRPAMAIFELLDYIVNEPPPKLPHGVFTTDFEEFVTKCLIKNPADRADLKML
MGHTFIKRAEVEEVDFAGWLCKTMGLHQPSTPTHSAE
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcaccaaaaagaagaccagtccccttgattataacccccactggagagggacagtca
accaacattgatgcagcagcagaggccaacctggaggccttgcagaggaagttaggtgag
ctggatttggatgaacagcagaggaagcgcctcgaagctttcctcacccagaaagcccag
gtgggcgagctcaaggatgaagatttcgaacccatatgtgaacttggcgctggtaatggt
ggagtggttcataaagtccgtcacaaaccctcgagactggttatggccaggaagcttata
cacttggaaatcaaaccagccatcaggaaccagattattcgagagctgcaggttctacac
gagtgtaactcaccgtacattgtagggttttacggcgccttctacagtgatggagaaatc
agcatctgtatggagcacatggatggaggctctttggatcaagtgctcaaagaagccaga
agaatccctgaggaaattttgggcaaagttagcatagctgtactcagaggtttggcgtat
cttcgggagaagcaccaaataatgcacagagacgttaagccctccaacatcctggtgaac
tcgcgcggtgagatcaaactgtgcgactttggtgtgagtggccagctcatcgactctatg
gccaactccttcgttggaacacggtcgtacatgtcgccggagagactccagggcacgcac
tactcggttcagtcggatgtgtggagcatgggcctatcactggttgagcttgctattgga
cgctaccccatcccccctcccgatgctaaggaactggaggccatatttggccggccagtg
ctggatgcaggtggggcagaaggtcacagcatgtctccaagacccaggcctccaggacga
ccagttagtggacacggaatggacagcaggccagcaatggctatatttgagctactggac
tacattgtcaatgagcctccacccaagctcccccatggcgtcttcaccacagactttgag
gagtttgtgacaaaatgcctcataaagaaccctgctgacagagctgacctcaagatgcta
atgggtcacacgttcatcaagcgggctgaggttgaggaggtggattttgctggatggttg
tgtaaaaccatgggccttcaccagcctagcacacccactcatagcgctgaatga

DBGET integrated database retrieval system