KEGG   Danio rerio (zebrafish): 100002366Help
Entry
100002366         CDS       T01004                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00052  Galactose metabolism
dre00500  Starch and sucrose metabolism
dre01100  Metabolic pathways
dre04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100002366 (gaa)
   00500 Starch and sucrose metabolism
    100002366 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100002366 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    100002366 (gaa)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100002366 (gaa)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100002366 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 100002366
NCBI-ProteinID: XP_001921957
ZFIN: ZDB-GENE-070212-2
LinkDB All DBs
Position
3
AA seq 918 aa AA seqDB search
MAIIRCLNTFAVLTCVLLIIVYEDNTICVAFSPSKERQHSSNISYRIIKAQKYSHNVSTV
PRDQCGIAVERRIDCARDRSLSRAECESRGCCYLPLPQSGLRGPPWCFYTVFYPGYKMGP
MLPTERGHRAILTRSAPSYLPRDIHTLQLDVMAETQDRLHLTLKDPTSPRYEVPFVKSQS
KGHKSMENPLYDVDFQPEPFGFSVRRKSNGRVLLNTTIGPLLFADQYLQLSTSLASSTVS
GLGEHYTPITLDLDWSSVSLWNRDMAPHRSANLYGSHPFFLVQEGDGQAHGVFLLNSNAM
EVFMQPAPALTWVTIGGILDFFIFLGPSPQSVIQQYQEVIGYPMMPPYWSLGFHLCRWGY
TSTNITRTVVQLMRQAKIPLDVQWNDLDYADQRRVFTFDPQRFGDLPQMVEDFHQLGMKY
VLILDPGISSASPPGSYKPFDDGLKKGVFINNSTGQILIGKVWPGPTAFPDFTNPTTQDW
WMDWIKDFYNKVPVDGLWIDMNEPSNFVQGSVDGCPDSELEKPPYTPGVIGGQLNSGTLC
VSAQQYLSNHYNLHNLYGLTEAIATHRALLKVKKTRPFVLSRSSFPGLGRFSAHWTGDVR
SDWEQLRFSIPAVLLFGLYGIPLVGADVCGFGGDTNEELCVRWTQLGAFYPFMRNHNDRP
NAPQEPYVFSQRAQDAMRMVINLRYSLLPFLYTLFHHAHTSASTVARPLFLQFPTDPDCR
SIDRQFLWGSSLLISPVLEQGAVEVMAYLPPGTWYSLHNGQTYYSKGQYIVFPASLDTII
VHVRERSIIPQQAPALTTAISRKNPFTLTVGLSVGNLAKGELFWDDGESLDTFERGDYSY
LLFFAEESYVVSKPIKLNGSLDGLVLGEVRVFGVQTPPTAVWANGQKVPDFSYRLDTKVL
TVAGLELPMTAKITIQWS
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggccataattagatgtttaaacacatttgcagtactgacttgtgtacttcttatcatt
gtgtatgaagacaacactatttgtgttgcattttcaccatcaaaagaaaggcagcatagt
tcaaatatctcatacaggatcattaaagcacagaagtacagtcataatgtatcaactgtt
cctagagatcagtgtggcatagctgtggagcgccgcattgactgtgctagggacagatct
ttgagtcgggctgaatgtgaaagcagaggatgctgttatttgcccctgcctcagtctgga
ttaagaggaccaccgtggtgtttctacacagtcttctacccaggatacaaaatggggccc
atgttgcctacagaacggggccacagggccattctcactcgttcagcaccttcatacctg
ccccgggacatccacacactgcagctagatgtgatggctgagactcaggatcgtcttcat
ctcactttgaaggatcctacatctccacgatatgaggttccctttgtgaagtcccaatcc
aaaggccacaagagcatggaaaatccactttatgatgttgatttccagccagaaccattt
gggtttagtgtacggcgaaaatccaatggccgtgttcttctgaacactacaataggccct
ctgctgtttgcagatcagtatctccagctctctaccagcctggcttcctctacagtctcg
ggactgggtgaacattacactcccatcacgctggacctcgactggagctctgtttcatta
tggaacagagacatggcaccacatagaagtgccaacctgtatggctcccaccctttcttc
ctggtccaagaaggtgatggacaggcacatggagtcttccttctcaacagcaatgcaatg
gaagtgtttatgcagcctgctccagcattaacatgggtgaccattggaggaattctggac
ttcttcatcttcttgggcccgagtcctcagagtgtgattcaacagtatcaggaggttata
ggatatcctatgatgcctccctactggtcactgggttttcatctgtgtcgttggggttat
acctccaccaacatcactaggacagtagttcagctcatgcggcaggccaagatacctttg
gatgtacagtggaatgaccttgattatgcagaccaaagaagagtctttactttcgacccg
cagcggtttggagatttgcctcaaatggtggaagatttccatcagctggggatgaaatat
gtgctcattcttgatccaggcatcagcagcgcgagtcctcctggttcatacaaaccgttt
gacgatggactgaagaaaggagttttcatcaacaactccactggacagatccttattggg
aaggtatggccgggtccgactgcattcccagatttcaccaatcctacaacacaggactgg
tggatggactggatcaaagacttttacaacaaggtacctgtggatggactttggatagac
atgaatgagccttcaaattttgtccagggctctgtggatggatgtcctgactctgaattg
gagaaaccaccatatacaccaggtgtgattggaggccagttaaactcaggaactctgtgt
gtgtccgcacagcagtatctgtccaatcattacaatctacacaacctctatgggctgacc
gaagccatcgccactcacagggcactgctaaaagtgaagaaaactcggccgtttgtttta
tctcgatcatcttttccgggactgggtcgtttctctgcacactggacaggagatgtgcga
agtgactgggaacaactgcgcttttcaatacccgctgtgctcctgtttggactgtatggc
attccattagtgggagctgatgtttgtggatttggtggagacactaacgaagagctgtgt
gtgcgctggacacaacttggagccttttaccccttcatgagaaaccacaatgacagacct
aatgctcctcaggagccatatgtatttagtcagcgagcccaggatgccatgaggatggtg
attaatcttcgatattctctcctgcccttcctctacacactcttccatcacgcgcacacc
tccgccagcaccgtggcccgccctctcttccttcagttccccactgatccagattgcagg
agcattgacagacagttcctgtgggggagttcactgctcatcagtccagttctggagcag
ggagcagtggaggtgatggcgtatctccccccggggacttggtacagtctgcacaatggc
caaacatattacagtaaaggacaatacattgtgtttcctgcttcgttggacaccatcatc
gttcacgtgagagagaggagcatcatcccacagcaggctcctgctctgaccactgcaata
tctcgcaaaaaccctttcaccctaacggtgggactgtcagtgggaaatttggccaaagga
gaacttttttgggatgatggagaaagtctggatacttttgagcggggagattattcatat
cttctcttctttgctgaagagtcatatgtggtcagtaaaccgatcaaattaaacggatct
cttgatggtttggtcctgggggaagtgcgtgttttcggggtccagactccacctactgcc
gtatgggccaacggacagaaagttcctgacttctcatacagattagataccaaggttctg
acagtagctggtctggaactaccaatgactgccaagatcacaatacagtggagctga

DBGET integrated database retrieval system