KEGG   Danio rerio (zebrafish): 100002479
Entry
100002479         CDS       T01004                                 

Gene name
epob
Definition
(RefSeq) erythropoietin b precursor
  KO
K05437  erythropoietin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100002479 (epob)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    100002479 (epob)
Cytokines and growth factors [BR:dre04052]
 Cytokines
  CSF and other factors
   100002479 (epob)
SSDB
Motif
Pfam: EPO_TPO YjfB_motility
Other DBs
NCBI-GeneID: 100002479
NCBI-ProteinID: NP_001373596
ZFIN: ZDB-GENE-141216-428
Ensembl: ENSDARG00000100737
Vega: OTTDARG00000041093
LinkDB
Position
10
AA seq 182 aa
MQTFSGLVLVLMVFVCLVSPLRPICDLRVLDHFVREAGDSEVIMRGCRGGCGVMKSYFVP
LTRVDFAVWEHIDVQMQAVEVQTGLSVLLQALNTARKTVSNSSLLNTLENNISNLHSLGQ
IIRSLHLQQAESTVLPDDSAPASSQTQEVSSLPELLQVQSSFLRGKVRLLLSAAPACQRQ
NS
NT seq 549 nt   +upstreamnt  +downstreamnt
atgcaaacgttttcaggtctggtgttggttttgatggtgttcgtttgtttggtctctccg
ctgcgccccatctgtgacctgagggttctggaccacttcgttcgagaagctggagattca
gaagtcatcatgcgaggctgcagaggaggctgtggagtgatgaaatcctactttgttcct
ctgacaagagttgactttgctgtttgggaacatatagatgttcagatgcaggccgtggag
gtccagacaggactgtctgtgctacttcaggcacttaatacggccaggaaaacagtcagc
aactcttcactattaaacacactagaaaacaacatcagtaacctccacagtctgggccag
atcatacgcagcctccatttacagcaggccgagtccacagttcttccagatgattcagct
cctgccagctcacagacgcaggaggtctcgtctctcccagaacttctgcaggtgcagagc
agcttcctgagaggaaaagtccgactcctgctttcagctgctccagcctgccaacggcaa
aacagctga

DBGET integrated database retrieval system