KEGG   Danio rerio (zebrafish): 100003514
Entry
100003514         CDS       T01004                                 

Gene name
prkcg
Definition
(RefSeq) protein kinase C alpha type-like
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04150  mTOR signaling pathway
dre04270  Vascular smooth muscle contraction
dre04310  Wnt signaling pathway
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100003514 (prkcg)
   04012 ErbB signaling pathway
    100003514 (prkcg)
   04310 Wnt signaling pathway
    100003514 (prkcg)
   04370 VEGF signaling pathway
    100003514 (prkcg)
   04020 Calcium signaling pathway
    100003514 (prkcg)
   04070 Phosphatidylinositol signaling system
    100003514 (prkcg)
   04150 mTOR signaling pathway
    100003514 (prkcg)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100003514 (prkcg)
   04540 Gap junction
    100003514 (prkcg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100003514 (prkcg)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100003514 (prkcg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100003514 (prkcg)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100003514 (prkcg)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100003514 (prkcg)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C Kinase-like APH C1_2
Other DBs
NCBI-GeneID: 100003514
NCBI-ProteinID: XP_001921715
ZFIN: ZDB-GENE-090206-1
Ensembl: ENSDARG00000004561
Vega: OTTDARG00000033057
LinkDB
Position
16
AA seq 695 aa
MSTPVSPSPSLSPLALSSPSPSSSPLPSPLSPPPRLPVFQRKGALKHKRVIEVKDHQFTA
RFFKQPTFCSHCTDFIWGIGKQGFQCQVCSFVVHKRCHEFVTFTCPGAITAPKPEDLKSK
HKFKVHTYSSPTFCDHCGSLLYGLIHQGMKCGCCDMNVHKRCESSVPSLCGQDHTEKRGR
IRLTVRGEKEDIYITVHEALNLIPMDPNGLSDPYVKLKLIPDPKSHSKQKTKTIRSTLNP
IWNESFTFSVRGRQWDRRLSVEVWDWDRTSRNDFMGALSFGVSEIFRRSVSGWFKLLNQD
EGEYYNIPVPDPDLQVPEEILMPSIPPTPSPVTTPVPAVTPPALSPAPAVLHTGKGHIGL
HDFNFLMVLGKGSFGKVLLAEEKGSERLFAIKMLKKDVLFQDEDTESAMVERRVLALSGR
PHFLTSLYCAFQTEDRLYYVMEYVNGGDLMFHIQIVGKFKEPHAAFYAAEIAVGLFFLHN
KGIIYRDLKLDNVLLDSEGHIKIADFGMCREGMMEGDTTRTFCGTPDYIAPEIVAYQPYG
KAVDWWSYGVLLYEMLAGQPPFDGIDEEELFQSIMEQSVSYPKSLSREAVAICKGLLTKN
PAKRLGGGEDAERELREHPFFRWIDWDRLERLEIQPPFKPRSGGKKGENFDKFFTSTSSA
LTPSDPDVLAAINQEEFQDFTFMNSEFPPSPLTAV
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgtccacaccggtgtctccgtctccttctctgtctcctctggctctatcgtctccgtct
ccgtcctcgtctcccctcccgtcccctctgtctcctccacccagactgccagtcttccag
aggaaaggagctctcaagcacaaaagggtgattgaggtgaaggaccaccagtttacggcc
cgcttcttcaagcagcccaccttctgcagtcattgcaccgatttcatctgggggatcgga
aagcaaggattccagtgtcaagtctgcagctttgtggtgcacaaacgctgccatgaattc
gtcactttcacttgtccaggagccatcactgctcccaaaccagaggatctgaagagcaaa
cacaagtttaaagtgcacacgtactccagtcccacgttctgtgatcactgcggttcactg
ctctatggcctcatacatcagggcatgaaatgtggctgttgtgatatgaatgtccacaag
cgctgtgagagcagtgtacccagtctctgtggacaagaccataccgaaaaaagaggacgg
atccgactgaccgtccgtggagaaaaggaggacatttatattacagttcatgaagcgctt
aacctcatacccatggaccccaacggcctgtcggacccttatgtgaagctcaaactcatc
cctgatccaaagagccacagcaaacagaaaactaaaaccatccgttccacactcaacccc
atctggaacgagagctttactttttcagtgcggggcagacagtgggacaggcgtttgtct
gtagaggtttgggactgggacagaacctcacgcaatgacttcatgggcgctctgtcattc
ggggtgagtgagatattcagacggtctgtcagcggctggttcaaactgctcaaccaggat
gagggagaatattataacatccctgtgcctgatccagacctgcaggtaccagaggagatt
ctgatgccctcaattcctcctactccttctcctgtgacgacgcctgttcccgctgtgacc
ccaccggctttgagcccagctcctgctgtcctgcacacgggtaaaggccacatcgggctg
cacgatttcaacttcctcatggttctgggaaaagggagttttggcaaggtcctgttggca
gaagagaagggcagcgagcgcttgtttgccataaagatgttaaagaaagacgtgctgttt
caggacgaggacacagagagcgccatggtggagagaagagtgctggccctctcgggacga
cctcacttcctgacctcgctctactgcgcctttcagaccgaggatcgtctgtattacgtc
atggagtatgtgaatggcggtgatcttatgtttcacatccaaatcgttggcaagtttaaa
gaaccacatgcagcgttttatgctgctgagattgctgtaggtctgttcttcctgcacaac
aaaggcatcatatacagagatctgaaactggacaatgtcttactggacagcgaaggacac
ataaagatagcagatttcgggatgtgtagggaaggcatgatggaaggagacaccacccgg
accttctgtggcacacctgattacatcgcgccagagattgtggcatatcagccctatggt
aaagcagtggattggtggtcatatggcgttctcctttatgagatgctggctgggcagcct
ccttttgatggcatagatgaggaggagctgtttcagtccatcatggaacagagtgtttca
tatcctaagagtctctctcgggaggccgtggccatctgtaaagggctcctcaccaagaac
cctgctaagcgtttgggaggaggagaggatgcggagagagagctgcgggagcatcctttt
ttccgctggatagactgggacagactggagagactggagatccagcctcctttcaagccc
agaagtgggggcaaaaaaggagagaactttgataagtttttcacatccacctcgtccgcc
ctcacaccttctgaccctgatgttctcgcagcaataaatcaagaggaattccaagacttc
accttcatgaattcagagtttcccccttcacccctcactgctgtctga

KEGG   Danio rerio (zebrafish): 100006675
Entry
100006675         CDS       T01004                                 

Gene name
prkcba
Definition
(RefSeq) protein kinase C, beta a
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04150  mTOR signaling pathway
dre04270  Vascular smooth muscle contraction
dre04310  Wnt signaling pathway
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100006675 (prkcba)
   04012 ErbB signaling pathway
    100006675 (prkcba)
   04310 Wnt signaling pathway
    100006675 (prkcba)
   04370 VEGF signaling pathway
    100006675 (prkcba)
   04020 Calcium signaling pathway
    100006675 (prkcba)
   04070 Phosphatidylinositol signaling system
    100006675 (prkcba)
   04150 mTOR signaling pathway
    100006675 (prkcba)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100006675 (prkcba)
   04540 Gap junction
    100006675 (prkcba)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100006675 (prkcba)
   04916 Melanogenesis
    100006675 (prkcba)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100006675 (prkcba)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100006675 (prkcba)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100006675 (prkcba)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100006675 (prkcba)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C Kinase-like APH C1_2
Other DBs
NCBI-GeneID: 100006675
NCBI-ProteinID: NP_957323
ZFIN: ZDB-GENE-040426-1354
Ensembl: ENSDARG00000008723
Vega: OTTDARG00000019451
UniProt: Q7T2C5
LinkDB
Position
1
AA seq 668 aa
MTESSDSDGKEGARGFARQGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQG
FQCQVCCFVVHKRCHEFVHFSCPGSDKGPASDDPRKYHSFKVHTYTSPTFCDHCGSLLYG
LIHQGMRCLNCLMNIHKRCFKHVPSLCGTDHTEKRGRLHFSASITGNVLSVSVKEARNLV
PMDPSGLSDPYVKLKLIPDPKSESKQKTKTIKGCLNPVWNEDFTFALKDTDKDRRLYVEV
WDWDRGTRNDYMGSMSFGISELMNQSVDGWFKILACEEGVFFNVPVYVDEEEGNKELSKR
FERAKIGPGTNNTDGASKNDLSKYDANGNQDRMKLADFNFIMVLGKGSFGKVMLAERKGS
DELYAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTHLHSCFQTMDRLYFVMEYIS
GGDLMFQIQQTGKFKEPLAVFYAGEIAIGLFFLHSKGIIYRDLKLDNVMLDSEGHIKIAD
FGMCKENMFDKDTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGLEGERDIKEHAFFRFVD
WERLQNKEVQPPYKPKSCGRDAGNFDLFFTRHPPILTPPDLEVIQNLDQEEFRGFSYVNT
KFASMKSK
NT seq 2007 nt   +upstreamnt  +downstreamnt
atgaccgagtcatcggattcagatggcaaggagggcgcgcggggattcgccaggcagggc
gcgctgaggcagaagaacgtgcacgaagtgaaggaccacaagttcatcgcgcgcttcttc
aagcagccgaccttctgcagccactgcaccgacttcatctggggtttcggcaaacaaggc
ttccagtgtcaagtgtgctgttttgtggttcacaaacgctgccatgagtttgttcacttc
tcctgcccagggtccgacaagggccctgcatcagatgaccctcgcaaatatcattcgttc
aaggtacacacatacaccagtcccacattctgtgaccactgtggatctctactgtacggc
ctcatacaccaagggatgagatgtttgaattgtctgatgaatattcataagcgatgcttt
aagcatgttcccagcctgtgtggaacagaccacactgagaagagagggaggctgcatttc
tctgctagtatcacaggcaatgttctcagtgtgtccgtcaaggaggctcgtaacttggtg
ccaatggatccaagcggcctgtcagatccatacgtgaagctcaaattaattccagaccca
aagagcgagagcaagcagaagaccaaaaccataaagggctgcctcaatccggtctggaac
gaagacttcacctttgccctcaaagacacagataaagacaggcgtctgtatgtggaggtg
tgggattgggatcggggcaccaggaatgactacatgggctccatgtcttttggcatctct
gagctgatgaaccaaagtgtggacggatggtttaagattctcgcttgtgaggaaggggtc
tttttcaacgttcctgtttatgtagatgaagaggagggcaacaaggagctgagtaagaga
tttgagagagccaagattggcccgggcactaataatacagatggcgcttcaaaaaatgac
ctctccaaatatgatgccaatggcaaccaagaccgcatgaagctcgcagacttcaacttc
atcatggtgctcggcaaaggcagctttggcaaggtgatgcttgcggagcgtaaaggttca
gacgagctgtacgcagtgaagatcttgaagaaggacgtggtgattcaggatgatgatgtg
gagtgcaccatggtggaaaagagagttctggctttgtctggaaaacccccgttcctcacg
catctccattcctgctttcagacgatggaccgtctttacttcgtgatggagtatatcagc
ggtggagacctgatgtttcagatacaacaaacgggaaagtttaaggagcccctcgctgtg
ttctatgctggagagattgccattggcctgttctttcttcattctaagggcattatttac
agagatctgaagctggataatgtgatgttggactctgaaggccacattaagattgcagat
tttggcatgtgcaaagagaacatgtttgataaagacacaacaaaaaccttctgtggcact
ccagattacatcgccccagagatcattgcatatcagccgtatggaaagtctgtggattgg
tgggcttatggagttctcctgtatgaaatgctggcaggacagcctccttttgatggtgag
gatgaagatgagctgttccagtccatcatggagcatcacgtgtcttaccccaaatccatg
tccaaagaagcagtcgccatatgcaaggggctgatgaccaagcatcccggtaaacgtctg
ggctgtggactggagggcgaacgggacattaaagagcatgctttcttccgtttcgtggac
tgggaaagactgcaaaacaaggaagttcaacctccatacaaacccaaatcttgcggtcga
gacgcagggaactttgatctttttttcactcgtcatcctccaatcctgacccctcctgac
ctggaagtgattcaaaacctggaccaagaggaatttcgaggcttctcatacgttaataca
aaatttgcatcgatgaaatccaagtag

KEGG   Danio rerio (zebrafish): 100333967
Entry
100333967         CDS       T01004                                 

Gene name
si:ch73-374l24.1
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04150  mTOR signaling pathway
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04310  Wnt signaling pathway
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100333967 (si:ch73-374l24.1)
   04012 ErbB signaling pathway
    100333967 (si:ch73-374l24.1)
   04310 Wnt signaling pathway
    100333967 (si:ch73-374l24.1)
   04370 VEGF signaling pathway
    100333967 (si:ch73-374l24.1)
   04020 Calcium signaling pathway
    100333967 (si:ch73-374l24.1)
   04070 Phosphatidylinositol signaling system
    100333967 (si:ch73-374l24.1)
   04150 mTOR signaling pathway
    100333967 (si:ch73-374l24.1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100333967 (si:ch73-374l24.1)
   04540 Gap junction
    100333967 (si:ch73-374l24.1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100333967 (si:ch73-374l24.1)
   04916 Melanogenesis
    100333967 (si:ch73-374l24.1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100333967 (si:ch73-374l24.1)
   04270 Vascular smooth muscle contraction
    100333967 (si:ch73-374l24.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100333967 (si:ch73-374l24.1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    100333967 (si:ch73-374l24.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100333967 (si:ch73-374l24.1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100333967 (si:ch73-374l24.1)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100333967 (si:ch73-374l24.1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 100333967
NCBI-ProteinID: XP_009298084
ZFIN: ZDB-GENE-141216-6
Ensembl: ENSDARG00000099841
Vega: OTTDARG00000042693
LinkDB
Position
3
AA seq 681 aa
MADHLIQINDSSAGVNRFARKGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHEFVSFSCPGADKGPDTDDPRSKHKFKIHSYGSPTFCDHCGSLL
YGLIHQGMKCDTCDMNVHKQCVMNVPSLCGTDHTERRGRIFMKIEVSGDRLHVTVGEARN
LIPMDPNGLSDPYVKLKLIPDPKNETKQKTRTIRSSLNPTWNESFIFKLKASDKERRLSV
EVWDWDRTTRNDFMGSMSFGVSELIKAPVSGWYKMLNQEEGEYYNVPIPEENDINLELRQ
KFEACQFNIHLLKKAKLGPGKKVITPTDHRRFSLPSGNMDKVRLNDFHFLALLGKGSFGK
VMLAEMKSTEELYAIKILKKDVVIQDDDVECTMVEKRVLAQREKPPFLTQLHSCFQTVDR
LYFVMEYINGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHRKGIIYRDLKLDNVMLD
SEGHIKIADFGMCKENMYEGMTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEML
AGQPPFDGEDEDELFQSIMEHNVSYPKSLTKEAVSICKGLMTKHPSKRLGCGAEGERDIK
EQAFFRRIDWDRLANREIQPPFKPKVCGKAAENFDKFFTRTQPMLTPPDQLVIANIDQSE
FAGFSFINPEFIHPASIHSVV
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggctgatcatctgatacagatcaatgactcgtccgccggagtcaatcgattcgcgcgg
aaaggagctctgcgacagaagaacgtgcacgaagttaaaaaccacaaatttatcgctcgc
ttcttcaagcagcccaccttctgcagccactgcaccgactttatctggggattcggcaag
caaggcttccagtgccaagtgtgctgttttgtggtccacaaaaggtgccatgagtttgtg
tccttctcctgtccaggggccgataagggcccagacacagatgatcccagaagcaagcac
aagtttaagatccacagctatggcagtcccacattctgcgaccactgcggatcgctgctg
tacggcctcatccaccagggcatgaaatgcgacacctgtgacatgaacgttcataagcag
tgtgtgatgaatgtgccaagtctgtgcgggacagaccacactgagcgcagaggacgaatc
ttcatgaagatcgaggtcagcggagacagacttcatgtcacagtgggtgaggctagaaat
ctgattcccatggaccccaatggcctttcagatccgtatgtgaagctcaaactcatccca
gaccccaagaacgagaccaaacagaagacccgcaccatccgctcctcgctcaaccccacc
tggaacgagtccttcatctttaagttaaaggcgtcagataaggagcggcgtctgtcagtg
gaggtgtgggattgggacagaaccacccgaaatgacttcatgggctccatgtccttcggt
gtgtctgagctgatcaaagctcctgtgtctgggtggtataagatgctgaaccaggaggag
ggtgagtactacaacgtacccatccccgaggagaatgacattaacttggagctgcggcag
aagtttgaggcctgtcagttcaatatccacctgctgaagaaagccaagctcggtcctgga
aagaaagtcatcacccccactgatcaccgacgcttcagtttaccgtccggaaacatggac
aaagttcgactcaatgacttccatttcctggctcttcttggcaaagggagttttgggaag
gtgatgttggcagagatgaagtccacagaggagttatacgctattaaaatcctgaaaaag
gatgtggtgatccaggatgatgacgtggagtgcacaatggtggagaagagagttctggcc
caaagagaaaagccacctttcctcacacaactacactcttgcttccagacagtggatcgt
ctgtactttgtaatggagtacattaacggcggagacctgatgtatcacatccagcaagtg
ggcaagtttaaggagccacaagctgtattctatgcggcagagattgcagtcggactcttc
tttcttcataggaagggaattatttacagagatctgaagctggacaacgtgatgctggac
tccgagggccacatcaagatcgcagacttcggcatgtgtaaggagaacatgtatgaggga
atgaccactcggaccttctgcgggacgccggattacatcgccccagagattatcgcctat
cagccgtatgggaaatcagtggactggtgggcttacggtgtgctcctgtacgagatgctg
gcggggcagcctccatttgatggagaggacgaggacgagctctttcagtccatcatggag
cacaatgtgtcctaccccaaatccctgactaaagaagctgtgtccatctgtaaagggctg
atgaccaagcatccatctaaacgtctgggttgtggagcggagggcgagagagatataaag
gagcaagctttcttccgcaggattgactgggaccgactggccaacagagagattcaacct
cctttcaaacccaaagtgtgcggcaaggcagcggagaactttgacaaattcttcacacgc
acgcagcccatgctgaccccacctgaccaactggtcatcgccaacatcgaccagagcgag
tttgctggattctccttcataaaccccgagttcatccacccagcgtctattcacagtgtg
gtatga

KEGG   Danio rerio (zebrafish): 393953
Entry
393953            CDS       T01004                                 

Gene name
prkcbb
Definition
(RefSeq) protein kinase C beta type
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04150  mTOR signaling pathway
dre04270  Vascular smooth muscle contraction
dre04310  Wnt signaling pathway
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    393953 (prkcbb)
   04012 ErbB signaling pathway
    393953 (prkcbb)
   04310 Wnt signaling pathway
    393953 (prkcbb)
   04370 VEGF signaling pathway
    393953 (prkcbb)
   04020 Calcium signaling pathway
    393953 (prkcbb)
   04070 Phosphatidylinositol signaling system
    393953 (prkcbb)
   04150 mTOR signaling pathway
    393953 (prkcbb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    393953 (prkcbb)
   04540 Gap junction
    393953 (prkcbb)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    393953 (prkcbb)
   04916 Melanogenesis
    393953 (prkcbb)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    393953 (prkcbb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    393953 (prkcbb)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     393953 (prkcbb)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   393953 (prkcbb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C CEP76-C2 C1_2 Kinase-like
Other DBs
NCBI-GeneID: 393953
NCBI-ProteinID: NP_957272
ZFIN: ZDB-GENE-040426-1178
Ensembl: ENSDARG00000022254
Vega: OTTDARG00000020068
UniProt: Q7SY24
LinkDB
Position
3
AA seq 670 aa
MAEPANSDGEERSAPMRGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFG
KQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSL
LYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEIKNNVLTVSIKEAK
NLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFNLKESDKDRRLS
VEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEEL
RQKFERAKIGPSKTDGSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKG
ADELFAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYI
NGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGVIYRDLKLDNVMLDAEGHIKIA
DFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDG
EDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYM
DWEKLEHREVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEGFSFIN
PEFPAMEAQS
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcagagccggcgaacagcgatggagaggagaggagcgcacccatgaggggttttgcc
cggcaaggcgccctgagacagaagaacgttcacgaagtcaagaaccacaagtttatcgct
cgcttcttcaagcagcctactttctgcagccactgcacggactttatctggggttttggg
aaacaaggatttcaatgtcaagtctgctgctttgtggtgcacaagcgttgccatgaattc
gtcaccttctcctgcccgggagcagataagggtcccgcatcagatgacccgcgcagtaag
cacaagttcaaggtccacacatactccagtccgaccttctgtgaccactgcggctctctg
ctgtacggcctcatccaccagggcatgagatgtgaccactgcatgatgaacatccacaag
cgctgtgtggccaacgtgccgagtctgtgtgggactgaccacaccgagaggaggggccgc
atccaaatcactgcagagatcaagaacaatgtgctcaccgtcagcattaaagaggcaaag
aacctggtacccatggaccccaatggcctctctgacccctacgtcaaactaaaactcatc
cctgaccccaagagcgagagcaaacagaagaccaagaccatcaagtgctgcctgaatccc
acatggaacgagaccttcacatttaatctgaaggagtctgacaaggaccgcaggctgtct
gtggagatctgggactgggacttgaccagccggaacgactttatgggctctctttctttt
ggcatttcagagcttcagaagcaaggagtggacggatggtttaagctgctcagtcaggaa
gagggcgagtatttcaatgtacctgtcccacctgagggagaagagggcaacgaggaactc
cgacagaagtttgagagagctaaaatcggtcccagcaaaacagatggctcctcctctaac
gccatctccaaattcgacagtaatggcaaccgggaccgcatgaaactgtctgacttcaac
ttcctcatggttctaggaaagggtagctttggaaaggtaatgttggctgagaggaaggga
gcggatgagctgtttgccataaagatcctgaagaaggacgtggtgatccaggacgatgat
gtcgaatgcactatggtggagaagagagtgctggctttgtcaggaaaacccccgttccta
acccagctgcactcctgctttcagacaatggaccgcctgtactttgtcatggaatacatc
aacggtggagatctcatgtaccatatccagcaggtcggcaagtttaaggagccccatgct
gtgttttatgctgcagaaattgccataggcctgttcttcctgcattcaaagggtgttatt
tacagagatctgaagttggataatgtcatgctggatgcagagggtcatatcaaaatcgct
gactttggcatgtgcaaagagaacatgcttgatggagtcaccaccaagaccttctgtgga
acccctgactacatcgcccctgagatcatcgcctaccagccgtatggaaagtcagtggac
tggtgggcttttggagttttgctatatgagatgctggctgggcagcctccgtttgatggc
gaggatgaggatgagctatttcagtccatcatggagcaccatgtttcctatcccaaatcc
atgtccaaggaggctgtggccatctgtaaagggctgatgaccaaacacccaggcaagcgt
ctgggctgcggtccggaaggtgagcgagacatcagggaacatggcttcttccgttatatg
gactgggagaagctggagcacagggaagttcagccaccatttaaaccaaaagcctgtggc
cgggatgcagagaactttgaccgctttttcacccgccatccaccggttctcacccctcca
gaccaggaggtcatcatgaacctcgaccaagacgaattcgagggcttttccttcataaac
cctgaattccctgccatggaagcccagagttaa

KEGG   Danio rerio (zebrafish): 497384
Entry
497384            CDS       T01004                                 

Gene name
prkcaa
Definition
(RefSeq) protein kinase C, alpha, a
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04150  mTOR signaling pathway
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04310  Wnt signaling pathway
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    497384 (prkcaa)
   04012 ErbB signaling pathway
    497384 (prkcaa)
   04310 Wnt signaling pathway
    497384 (prkcaa)
   04370 VEGF signaling pathway
    497384 (prkcaa)
   04020 Calcium signaling pathway
    497384 (prkcaa)
   04070 Phosphatidylinositol signaling system
    497384 (prkcaa)
   04150 mTOR signaling pathway
    497384 (prkcaa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    497384 (prkcaa)
   04540 Gap junction
    497384 (prkcaa)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    497384 (prkcaa)
   04916 Melanogenesis
    497384 (prkcaa)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    497384 (prkcaa)
   04270 Vascular smooth muscle contraction
    497384 (prkcaa)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    497384 (prkcaa)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    497384 (prkcaa)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     497384 (prkcaa)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   497384 (prkcaa)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    497384 (prkcaa)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 497384
NCBI-ProteinID: NP_001243170
ZFIN: ZDB-GENE-050208-100
Ensembl: ENSDARG00000115657
Vega: OTTDARG00000027246
UniProt: A0A2R8QIY5
LinkDB
Position
6
AA seq 670 aa
MADTQSNEQSSSDVANRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHELVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLL
YGLIHQGMKCDSCDMNVHKQCVMNVPSLCGTDHTERRGRLYMKIEVIGDKMHVTVGEGKN
LIPMDPNGLSDPYVKLKLIPDPKNETKQKTKTIRSSLNPTWNETFTFKLKPADKDRRLAV
EVWDWDRTTRNDFMGSMSFGVSELMKSPVCGWYKMLNQEEGEYYNVPIPDEDDPDTELRQ
KFEIAKLGPPKKNITALDDSGSSITSSNVDNVRLSDFNFLAVLGKGSFGKVMLAEMKSSD
ELFAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNG
GDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHKKGIIYRDLKLDNVMLDAEGHIKIADF
GMCKENIVEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGED
EDELFQSIMEHNVSYSKTLSKEAVSICKGLMTKHPSKRLGCGQEGERDIREHAFFRRIDW
DRLANREVQPPFKPKVCGKGAENFDKFFTRTQPQLTPPDELVIANIDQADFDGFTFVNPQ
FVHPSLVNTE
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggctgatacacaaagcaacgagcaatcctcgtctgacgttgcaaatcgatttgcccgt
aaaggtgctttgaggcagaaaaacgtccatgaagtgaaaaaccataaattcaccgcgagg
tttttcaagcagccgactttctgcagtcattgcactgacttcatttgggggtttggaaag
caaggatttcagtgccaagtgtgctgttttgttgtccataaacgttgccatgaacttgtc
acattctcatgccctggagcagataaagggccagatacagatgatcctaggagcaagcac
aaatttaagatccacacttatggcagtcccacattctgtgaccactgtgggtctcttcta
tatggactcatacaccaaggaatgaaatgtgactcctgtgatatgaatgtccataagcag
tgtgtgatgaatgtgccaagcctttgtggaacggaccacacagagagacggggacgcctt
tacatgaagattgaggtgattggcgacaaaatgcatgtcacagttggtgaaggcaagaac
ttgattccgatggacccaaatggattgtctgatccatatgtaaaactcaagttgattcca
gaccctaaaaatgagactaaacagaaaacaaaaaccattcgctcctccctgaatccaact
tggaacgaaacgtttacatttaagctgaagccagcagataaggaccgccgactggctgtg
gaggtatgggactgggacagaaccacccgcaatgacttcatgggctcaatgtcttttggt
gtgtcggagctcatgaagtccccagtatgtggctggtacaaaatgttaaaccaggaggag
ggggagtactataatgtgcccattccagatgaagatgaccccgatactgaactccgacag
aaatttgagatagccaaattgggtcctcccaaaaaaaacattaccgctttggatgacagt
gggtccagcataacttccagcaatgtggacaatgtcaggctctcagattttaatttcctg
gcagtacttggaaaaggcagctttggaaaggtcatgctggcagagatgaagtcttctgat
gaactatttgctataaaaatcctgaagaaggatgtggtcatccaggatgacgatgttgaa
tgcaccatggtggagaagcgagttctggctcagcaggacaagcctccattcctcacccag
cttcattcctgcttccagactgtggatcgcctgtattttgtgatggagtatgttaatggt
ggtgatcttatgtatcacatccagcaagtaggcaaatttaaggagccccaggctgtgttc
tatgctgcagagattgctgttgggctcttcttcttgcacaagaaaggaattatatacaga
gacctaaaattagataatgttatgctggacgcagagggtcatattaagattgctgacttt
ggtatgtgcaaggagaacattgtggagggtgtgaccacccgtacattttgtggaacgcca
gactacatcgctccagagataatagcatatcagccatatggtcgctctgtggactggtgg
gcttatggagtccttctgtatgagatgctggctggacaacctccatttgatggtgaggat
gaagatgaacttttccagtctattatggaacacaatgtctcctactctaaaaccttgtcc
aaagaagcagtttccatctgcaaagggctgatgaccaaacacccttcaaaacgcctgggc
tgtggtcaagagggtgagagagatattagggaacatgctttcttccgtcgcattgactgg
gatcgcctggcaaacagagaagtacagcctccattcaaacccaaagtgtgtggaaagggg
gcagaaaactttgacaagttcttcactcgcacgcagccacaactgacccctcctgacgag
ctggttattgccaacatcgaccaggctgatttcgatggatttaccttcgtcaatcctcaa
tttgtccatccctcccttgtcaacactgaataa

DBGET integrated database retrieval system