KEGG   Danio rerio (zebrafish): 100004261Help
Entry
100004261         CDS       T01004                                 

Gene name
map3k14a
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04210  Apoptosis
dre04625  C-type lectin receptor signaling pathway
dre04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100004261 (map3k14a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100004261 (map3k14a)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100004261 (map3k14a)
   04672 Intestinal immune network for IgA production
    100004261 (map3k14a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100004261 (map3k14a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100004261 (map3k14a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  Other
   100004261 (map3k14a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo FTA2 SNAD2
Motif
Other DBs
NCBI-GeneID: 100004261
NCBI-ProteinID: XP_002661254
ZFIN: ZDB-GENE-120215-80
Ensembl: ENSDARG00000074060
Vega: OTTDARG00000037548
UniProt: E7FEY1
LinkDB All DBs
Position
3
AA seq 825 aa AA seqDB search
MQVQRIWNSTVPFSHMAHSDIKAVNRLGSGPDSSTESEGGELEKIVHNSALWKIINHGTA
KYEWTHGTEKQSIIAQAECESQDSQEFCPNGSISSQLVLSSISRNRPRKKRKRPRRKQGK
NVSQANVSVGVTRVPEQDSGEGSSINQVREPVFFSSNSSSTYSTERVSIQETEGPSDSHQ
WESQQTSFFSPSQSYAEESEELKSQLRSEIECSLAVTALRDYVTTEEPCFAYGFVKDVLR
QKREKDEDEREDSDKNEGILFKEGLQPVNSEYREGREYEQCRFLKQGSFGEVYSIKDKGT
GFICAAKKVPLENFSTEEVGTWSALQSPQVVELFGVVREGPSIVLFMDLKPSSLGQLVEE
RGRLPEDLSLHYLQQVLGALHYLHRKRVLHLDIKADNVLLSEDGKDAFLCDFGQSERLDK
QGLSYCQGLKGTETHMAPEVVLNEYHSSKVDIWSSCCMFLHMLNGCHPWTRYYSRPLCLK
IATEPPPLREIPHDCSSHTAEVIKAGLQKDPIKRASAKELSFKTAKALKKVGGLRSQVRG
GAYQKPLGKPDSAHSATPTKSNNAMPSHNSELQWMSSEQKRNKADGKRNDKTKQKKQTKD
TRNDDHSPPKALLHIQHTSPKPQVSKKTEREPTVPEQELRKLEKDFLLSSLSHLPSAELQ
EQLLSCISSDCLSTRECCDKKDSGRWSVSPGDYDSSGVFSDNSQYDGQTFSRDWLSPTHQ
PLSRCFEGVDVYIRDFNGRCIHIRETPRVKVGHIARGISDQISESVFSLQTEDGFLVPHD
KEVLENSLLLLCVPAPDVSLCHQYSSDDSGWSWRIREGLLETRDN
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgcaaagaatttggaactccaccgtcccattctctcacatggcccatagtgat
ataaaagctgtcaaccgccttggctcaggtccagactctagcacagagagcgaaggagga
gagctggaaaaaatagttcataacagcgctctgtggaagatcataaatcacggaactgcc
aaatatgagtggacacacgggacagagaaacagtccattattgcacaggcggagtgtgag
tctcaggattcacaggagttctgccccaatggcagcatctcctcccagttggttctcagc
tccatcagtcgtaaccggcccagaaagaaacgtaagaggccgcgacggaaacagggcaag
aacgtcagccaagcaaatgtgtctgtgggagtcaccagagtgccagaacaggacagcgga
gaagggtcgtctatcaatcaggttagagagccagtgttcttcagcagcaacagtagcagc
acatacagcacagaaagagtatccatccaggaaaccgagggtccatcagactctcatcag
tgggagtcacagcagacctcctttttctcccctagccagagttatgccgaagagagcgag
gagctgaagtctcagctgagaagcgaaatcgaatgctctttggcagtcacggccctcaga
gactatgtaacaacagaagaaccctgctttgcatacggctttgtaaaagacgtgctgaga
caaaagagggagaaggacgaggacgaaagagaggacagcgataagaacgaaggcatcctg
ttcaaagagggccttcaaccagtgaattctgagtacagagagggccgggagtatgagcaa
tgtagatttctcaagcagggctcttttggagaggtctacagcatcaaagacaaaggcaca
ggcttcatttgtgctgccaaaaaggtgccgctggaaaatttcagcactgaggaggtgggc
acgtggagcgccctgcagtctcctcaggtggtggaactctttggggtggtgcgtgaaggt
ccatccatcgtccttttcatggacctcaaacccagttctctaggacagctggtggaggaa
cgaggccgtctgccagaggatctgtccctgcattaccttcagcaagtactaggggcacta
cactacctgcataggaaacgtgtgcttcatctggacatcaaagctgataatgttttgctg
tccgaggatgggaaagatgcattcctgtgtgatttcggccagtcagagagactggacaaa
caagggcttagttattgtcagggattgaaaggcacagagactcatatggcacctgaggtg
gtgctcaatgagtaccactcttcaaaagtcgacatctggagcagctgctgtatgtttctg
cacatgctcaatggctgtcatccgtggacccgctattattctaggccactgtgcctcaag
atagcaacagagcctccgccactgagagaaatcccacacgactgcagctcccatacagct
gaggtcataaaagcaggactacagaaggatccaatcaaacgagcctctgccaaagagctc
tcctttaaaactgccaaagcactcaaaaaagtcggtggactacgcagccaagtgaggggc
ggagcctatcagaagccactggggaaaccagactccgcccattcagctacgcccacaaaa
tccaataatgccatgccctctcacaactctgagctgcagtggatgagctcagagcagaag
aggaacaaggctgacgggaaacgcaatgacaagacgaaacagaagaaacaaacaaaggac
acaagaaacgacgaccactctccacccaaagcactgctgcacattcaacacacttcacct
aagccacaagtcagcaaaaagactgaacgagaaccaacagtgccggaacaagagctgagg
aaactagaaaaagatttcctcttgagcagcctctctcatcttccctctgctgagcttcaa
gagcagcttctctcctgtatcagcagtgactgtctctccactagagaatgctgtgacaaa
aaggattcaggccgttggtcagtcagtcctggtgattatgacagctcaggtgtgttttcc
gacaatagccagtatgacgggcagaccttcagccgtgactggctctctccaactcaccag
cctctgtcacgctgctttgagggggtggatgtttacatccgagactttaatggtagatgc
attcatattcgagagacacccagagtgaaagtaggacacattgcacgaggaatcagcgat
cagatctcagagagtgttttcagtttgcaaacggaggatggttttctggttccacatgat
aaagaggtgctggagaacagtctgttgctgctttgcgttcctgctccagacgtcagcctc
tgtcatcagtacagcagcgatgacagtggctggagctggaggatcagagagggtcttctg
gagaccagagataactga

DBGET integrated database retrieval system