KEGG   Danio rerio (zebrafish): 100004455
Entry
100004455         CDS       T01004                                 

Gene name
epoa
Definition
(RefSeq) erythropoietin isoform L2 precursor
  KO
K05437  erythropoietin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100004455 (epoa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    100004455 (epoa)
Cytokines and growth factors [BR:dre04052]
 Cytokines
  CSF and other factors
   100004455 (epoa)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100004455
NCBI-ProteinID: NP_001033098
ZFIN: ZDB-GENE-061218-3
Ensembl: ENSDARG00000055163
Vega: OTTDARG00000027347
UniProt: Q2XNF5 B3DI26
LinkDB
Position
7
AA seq 183 aa
MFHGSGLFALLLMVLEWTRPGLSSPLRPICDLRVLDHFIKEAWDAEAAMRTCKDDCSIAT
NVTVPLTRVDFEVWEAMNIEEQAQEVQSGLHMLNEAIGSLQISNQTEVLQSHIDASIRNI
ASIRQVLRSLSIPEYVPPTSSGEDKETQKISSISELFQVHVNFLRGKARLLLANAPVCRQ
GVS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtttcacggttcaggactctttgccttactgctgatggtgctggagtggacccgtcca
ggcctgtcctccccattacgccccatctgtgacctgcgcgtcctcgaccatttcattaag
gaggcatgggatgcagaggctgctatgagaacttgtaaggacgattgcagcattgcaacg
aacgtcactgttcctctgaccagagtcgattttgaagtctgggaagcgatgaatatagag
gagcaagctcaggaggtccagtcaggcttacacatgctgaacgaggccatcggctcatta
cagatatctaatcagactgaagtgcttcagtctcacatagatgccagtattagaaacatc
gccagcatcagacaagtgctgcgaagtctcagcataccggaatatgtacctccaaccagt
agtggagaagacaaggagacacagaaaatatcctcgatctcagagctgtttcaggtccat
gtcaactttcttcggggaaaagcgcgtctgctgctcgccaatgcacctgtctgtcgacag
ggtgtcagctga

DBGET integrated database retrieval system