KEGG   Danio rerio (zebrafish): 100005049
Entry
100005049         CDS       T01004                                 

Gene name
fgf1b
Definition
(RefSeq) fibroblast growth factor 1b
  KO
K18496  fibroblast growth factor 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100005049 (fgf1b)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100005049 (fgf1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    100005049 (fgf1b)
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    100005049 (fgf1b)
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   100005049 (fgf1b)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100005049 (fgf1b)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100005049
NCBI-ProteinID: NP_001098748
ZFIN: ZDB-GENE-071004-7
Ensembl: ENSDARG00000042811
UniProt: A7YT71
LinkDB
Position
21
AA seq 158 aa
MTERDFTAFALLSSTTDNRDTKHNSLIKLHCRNGGFHLRILPSGTVDASRQDNDINTLLK
VKAVKAGVVAIRGHETGLYLAMDKCGRLYGTAVLNEECFFIEKMEENHYNTYRSQRYQDN
GDWFVGIRKNGRTKDGSRTHKGQNAVYFLPIPVDGSVQ
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaccgagcgggatttcactgcttttgcactgctgtcttccactacagacaacagagac
acaaaacacaactctctcataaaactccactgcagaaatggaggatttcatctccggatc
ctacccagcgggacggtggacgcgagccgacaagacaacgacattaacactcttttaaag
gtaaaagcagtgaaagcaggagttgtggccatcagaggtcatgagactggactatacctt
gcaatggacaaatgtggaagactttatggcaccgctgtgctgaatgaagagtgtttcttc
attgagaagatggaggaaaatcactacaacacataccgttcgcagagatatcaggacaac
ggagactggtttgtgggcatcagaaagaacggacggacaaaagacggctccagaacacac
aagggccaaaatgcagtctacttcctaccgattccagtggatggcagcgtacagtaa

DBGET integrated database retrieval system