KEGG   Danio rerio (zebrafish): 100005716Help
Entry
100005716         CDS       T01004                                 

Gene name
pcsk1
Definition
(RefSeq) neuroendocrine convertase 1 precursor
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dre01002]
    100005716 (pcsk1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dre03110]
    100005716 (pcsk1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100005716 (pcsk1)
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S8: subtilisin family
   100005716 (pcsk1)
Chaperones and folding catalysts [BR:dre03110]
 Intramolecular chaperones
  Subtilisin family
   100005716 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 100005716
NCBI-ProteinID: NP_001131134
ZFIN: ZDB-GENE-071009-1
Ensembl: ENSDARG00000002600
Vega: OTTDARG00000026857
UniProt: B6VCA1
LinkDB All DBs
Position
21
AA seq 755 aa AA seqDB search
MEERCRPMLLCSVLALVCALVSSAVDRQYLNEWAVEIPGGVQNARSIADEFGYQLVRQIG
ALENHYLFKRHSHPSRTKRSADHITKRLSEDDRVSWAEQQYEKRRAKRAPLGVECKDCSV
DKLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDI
YPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGG
IRMLDGIVTDAIEASSIGYNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRG
GKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSS
GDYTDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSEF
DPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVRDETFQPR
PLKAAGEISIEIPTKACAGQANSVMSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLA
ERERDTSSNGFRNWAFMSVHTWGENPTGTWILKITDTSGRMENEGQIISWKLILHGTSEK
PEHMKKARVYTPYNAVQNDRRGVEPMEDMMKQEAPTPALKPEIPNQAIPDSPPSTASMSI
PEVNSGPSTANLALLRLLQSAFNRQMPAAPPKSFQQERIPPQKLYQALDLLNRYRASQNG
LFNDYSDNFYRAQPYRHRDDRLLQALFDMLRDDQQ
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagatgtcgtccaatgttgctgtgcagtgttcttgctctggtgtgtgcgctc
gtgtcttcagccgtggacaggcagtatctcaacgaatgggcggtggagattcctggagga
gtccaaaatgcacgatccatcgccgacgagttcggataccaattagtccgacagattggg
gcgctggaaaaccattatttattcaagcggcacagtcaccctagcaggaccaaacggagt
gcagatcatatcaccaaacgtctgtcggaagatgacagggtgtcttgggccgaacagcag
tatgagaaacggagggctaagcgggcgccgctgggggtcgaatgtaaggactgttcagtg
gacaaactcttcgacgaccccatgtggaaccagcagtggtatctgcaagacacccggaca
tcatcatcccttcccaaactagacctgcatgtgatccccgtctggaagaagggcatcacg
ggaaaaggagtggtcattactgtactggatgacggtctggagtggaaccacaccgacatt
tatccaaactacgatcctgctgctagctatgactttaacgacaacgatccggatcccttc
cccagatacgactccaccaatgaaaacaagcatggtaccagatgtgctggagagattgcc
atgcaagcagacaacaacaaatgtggcgttggagtggcctacaactcgaaagtgggaggg
atacgaatgctggatggaatcgtgactgatgccattgaagccagttccattggttataac
cctgaccatgtggacatctacagtgctagctggggtcctaatgatgatgggaagactgtg
gaggggcctggacgccttgcccagaaagcttttgagtacggtattcagaaggggcgtggt
ggtaaaggctccatttttgtgtgggcgtctggtaacgggggtcgacagggcgataactgt
gactgtgatggatacacagacagtctgtacaccatctccatcagcagcgcatcccagcag
ggtttgtccccgtggtacgctgagaaatgctcctccacgctggccacggcctacagcagc
ggagactacaccgaccagagaataactagtgctgatttgcacaatgaatgcacagagaca
cacactggcacatctgcatctgccccactggctgctgggatatttgcactggctttggag
caaaatcccgatctgacatggcgggaccttcagcacttggtggtttggacgtctgagttt
gaccctctcgccaataaccccggctggaaaaggaacggagctggactgatggtcaacagt
cgttttgggtttggtctcctgaatgccaaagccctggtggacctggccgatcctaaagtc
tggaaacacgttcccgagaagaaacagtgcatcgtcagagatgagacgtttcaaccaaga
ccattgaaggctgcgggcgagatctccattgagatccccactaaagcctgtgcaggacag
gcaaattctgtcatgtccttggagcatgtgcaggtggaggtgagcattgagtatacaaga
agaggagacctccacatcacactcacatctccatcaggtaccactacagtcctactggcg
gagagagagagggacacttcatctaatggtttccgaaactgggccttcatgtctgtgcac
acatggggagagaatcccactggcacttggatcctgaagatcactgatacgtcaggacgg
atggagaatgagggtcagatcatcagctggaagttaattttgcacgggacgtctgagaag
cctgaacacatgaagaaggcgagagtatacacaccgtacaacgccgtacaaaatgatcgc
agaggagtggagccgatggaagacatgatgaagcaggaagctccaactccagctctcaaa
cctgagattccaaatcaagcgatcccagactctccgccttccactgcctccatgagcatc
ccagaagtaaactccggcccgtccactgccaacctggccctgctgcgtctccttcagtca
gccttcaacaggcagatgccggcggctcccccgaagagcttccagcaggagcgcatcccg
ccacagaagctgtatcaggccctagacctgctgaaccgctacagggcctcccaaaacggc
ctgttcaatgactacagcgacaacttctacagagcccagccgtacagacacagagacgac
cggctgctgcaggctctgttcgacatgctccgggacgaccagcagtga

DBGET integrated database retrieval system