KEGG   Danio rerio (zebrafish): 100006951
Entry
100006951         CDS       T01004                                 

Gene name
nrg2a
Definition
(RefSeq) neuregulin 2a
  KO
K05456  neuregulin 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100006951 (nrg2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    100006951 (nrg2a)
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   100006951 (nrg2a)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set Ig_4 EGF_2 Ig_5 DUF3169 Neur_chan_memb EGF
Other DBs
NCBI-GeneID: 100006951
NCBI-ProteinID: NP_001092724
ZFIN: ZDB-GENE-070615-10
Ensembl: ENSDARG00000077818
Vega: OTTDARG00000028365
UniProt: A5D6U9
LinkDB
Position
21
AA seq 488 aa
MKNPVLADEGSRLIVKCEATGSPAPEYKWYKDGAELKRSKEIKIRNNKKNSKVQIGSAKL
EDSGNYTCVAENILGKANGTSTVHVQSITTTVSPGSGHARRCNDTEKTYCVNGGDCYYIH
GINQLSCKCPDGYFGPRCLQTEPLRLYMPKPNKKAEELYQKRVLTITGICVALLVVGIVC
VVAYCKTKKQRKKMHNHLRQNIYVDHPNRNLANGPNHPGPGPEEIPMVDYISKNVPATER
VIRHGAEAPFPGSRQSSRSHNSSTRAHSSTHRYVSALTTPARLSPVDFHYSLPPQVPTFQ
ITSPNASHAMSLPPAAHAPYPPEEDQPLLRRYQVPLHEARGHEPYRQQQRGSYLRDSTGS
LPSSPYRLAQEDEYESTQEYLSSMEQPKRSSRRWRRSRLNGHVAPRGYQPSRDLGSRSCL
SDSDSEEEEGESTPFLSMQNMNAAEPSALYRPVPDTRTSHAQSGRHGSRANTQTRLTHSR
SKPDNAPH
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaagaatccagtgttggcagacgaaggaagcaggctgattgtgaagtgcgaggccact
ggtagccccgccccagagtacaagtggtataaagatggcgctgaactgaagaggagcaaa
gagatcaaaatcaggaacaacaagaaaaactccaaagttcagatcggcagtgcaaagctg
gaggattctgggaattacacatgtgtggcagagaatattctggggaaggctaacggcacc
agcacagtgcacgtacaaagcataaccacaacagtatctccgggttcgggccatgccaga
agatgcaacgacacagagaagacatactgcgtcaatggcggcgactgttactacatacat
ggtataaatcagctgtcctgcaaatgtccggacggatacttcggcccgcggtgcttgcag
acagagcccctgcggttatacatgcccaaacctaataaaaaggcagaggagctttatcag
aagagagtcctgacaatcaccggcatctgtgtggctcttttagtggtgggcatagtctgt
gtggtggcctactgcaaaaccaagaaacagaggaagaagatgcacaatcatctgaggcag
aacatctacgtggatcatccaaatcgcaacctggccaatggacccaatcacccggggcct
ggtcctgaggagattcccatggtagattatatctccaaaaatgtgccggcaactgagaga
gtaattcggcacggagcagaggcaccttttcctggcagccgtcagtcttccagatcccac
aactcctccacccgggctcattcctccacccacaggtatgtgtcagcgctgaccacgccg
gctcgcctgtctcccgtggacttccattactcactgcccccgcaggtgcctaccttccag
atcacgtctcccaatgccagccacgccatgtctctgcctcctgccgcccacgctccctac
ccgccagaggaggaccagcccctgctgcggcggtaccaggtgcccctgcatgaggcacgt
ggccacgaaccctaccggcagcagcagcgcggcagctacctacgagacagcacgggcagc
cttccctccagcccataccggctggctcaggaggatgagtatgaaagcacccaggagtac
ctctcctcgatggagcaaccaaagagaagcagtaggcgctggcgcaggtccaggctcaat
ggccacgtggcgccacgcggctaccagccgtccagggacttgggttcacgcagctgcttg
tctgacagtgactcggaagaagaggaaggtgagagcacgcccttcctcagtatgcagaac
atgaatgccgccgagccctctgccctctacaggcctgtgcctgacacgcggacttctcac
gcccagagcgggcggcatgggtctcgcgccaacacacagaccagactgacgcactcgcga
tccaaaccggacaatgcaccccactag

KEGG   Danio rerio (zebrafish): 100270726
Entry
100270726         CDS       T01004                                 

Gene name
nrg2b
Definition
(RefSeq) neuregulin 2b
  KO
K05456  neuregulin 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100270726 (nrg2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    100270726 (nrg2b)
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   100270726 (nrg2b)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 ig Ig_2 V-set Ig_6 Ig_5 C2-set_2 DUF3169 Izumo-Ig Ig_4 C1-set EGF EphA2_TM Neur_chan_memb
Other DBs
NCBI-GeneID: 100270726
NCBI-ProteinID: NP_001138563
ZFIN: ZDB-GENE-090205-2
Ensembl: ENSDARG00000086585
Vega: OTTDARG00000041990
UniProt: B9VQL5
LinkDB
Position
14
AA seq 599 aa
MREISYRNCGRMRERTTDRRRKDGLREGKKRASAPKVKPMDSQWLQEGKKLTLKCEAVGN
PSPSFNWYKDGSQLRQKKTVKIKTNKKNSKLHISKVRLEDSGNYTCVVENSLGRENATSF
VSVQSITTTLSPGSSHARKCNETEKTYCINGGDCYFIHGINQLSCKCPNDYTGERCQTSV
MAGFYKHLGIEIMEAEELYQKRVLTITGICVALLVVGIVCVVAYRKTKKQRKKMHNHLHQ
NMCAEHPNRMLANGPNHPGPGPEEIPMVDYISKNVPATERVVRHGTETSGNFSGSRMSSR
SHHTSTASHTSSHRHEERTWSMEWTDSIHSDCQSGALSSSVGTSKCSSSACMEARARRVA
YCGYPDATQCSLQYGDSYDSLRDSPHSDRYVSALTTPARLSPVDFHSSLPPQVPTFQITT
PNASHALSLPPAASAIAMAAYSPDDDQPLLYRYRRSRRPYYAAESTGSLPSSPYRFVDDE
DYETTQEYMSSREQPKKSSGSRRWRRRLRINGHTPGPRNYSSQSCLSDSEWEDEEVGDLG
HGESTPFLSMQNMNATEPATIYRPNDTRTFSNTGRSGSRPNVQANKLTQSRFRPDNAPL
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgagggagatcagctaccgcaactgcgggaggatgagagagagaacgactgacagaagg
aggaaagatggactgcgggagggaaaaaagagggcatcagctccaaaggtgaagcccatg
gattctcagtggctccaggaaggtaaaaagttgacactgaagtgtgaagctgtgggcaac
ccgagcccctccttcaactggtacaaagatggcagccagcttcgccaaaagaaaaccgtc
aaaatcaaaaccaacaagaaaaactcaaagcttcacattagcaaagtcagactggaggat
tctgggaactacacctgtgtggtggagaactcgctgggcagagaaaacgccaccagcttc
gtcagcgtccaaagcataaccaccacattgtctccgggctcaagtcatgccaggaagtgc
aatgaaactgagaagacatactgcatcaacggtggagactgttatttcatacatggtata
aatcagctgtcctgcaagtgtccaaatgactataccggcgaacgctgtcaaacctccgtt
atggccggtttctacaagcatcttggaattgaaatcatggaggctgaggagctgtaccaa
aaacgagtgctgacgataactggcatctgcgtggctctgctggtggttggcatcgtgtgc
gtggtggcataccgcaaaaccaagaaacaaagaaagaagatgcataaccatctgcaccag
aacatgtgtgcggagcatccaaaccgcatgctggccaacggacccaaccatcctggcccc
gggcctgaggagatccccatggtggattatatatctaagaatgtcccggcaactgaacga
gtagtacgacatggaactgaaacatcaggcaatttctcgggcagccgaatgtcgtcacgg
tcccaccacacctccacagcgtctcacacttccagccaccggcacgaggagcgcacatgg
agtatggagtggacggacagcattcattcagattgccagtcgggggcgctctcctcctcc
gtcggcaccagtaaatgcagtagctcggcgtgtatggaggcacgtgcccgccgtgtcgcc
tactgtggttatcctgatgccacacagtgctctctgcagtatggagactcgtatgactcc
ctgcgggactcgcctcacagcgacaggtacgtgtctgctctgaccacgcctgctcgtctc
tcaccggtggactttcactcctcactgcccccgcaggtgcctacctttcagatcaccaca
cccaacgccagccacgccctgtccctgccgcccgccgcctcggccattgcaatggcggct
tactcgcccgacgatgaccagcccctgctgtaccgctaccgccgctcccggcggccatat
tatgcggcagagagcacaggctcccttccgtccagcccgtaccgcttcgtggacgatgag
gattacgagaccacacaggaatacatgtcctcccgagagcagccaaaaaaaagcagcggc
agccggcgttggcgcaggagattgcggatcaacgggcacactccaggccctaggaactac
agttctcaaagctgcctgtcagacagcgagtgggaggacgaggaggtcggtgacctcggc
cacggcgagagcacgccatttctcagtatgcagaacatgaacgccaccgaaccggccacc
atctaccgacccaacgacacgcggactttcagcaacacgggacgctcgggctcccgacct
aacgtgcaggccaacaaactgacacagtcgcggttcagaccggacaatgcacccctttaa

DBGET integrated database retrieval system