KEGG   Danio rerio (zebrafish): 100007677
Entry
100007677         CDS       T01004                                 

Gene name
erbb4a
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4 precursor
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100007677 (erbb4a)
   04012 ErbB signaling pathway
    100007677 (erbb4a)
   04020 Calcium signaling pathway
    100007677 (erbb4a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100007677 (erbb4a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100007677 (erbb4a)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100007677 (erbb4a)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 100007677
NCBI-ProteinID: NP_001137223
ZFIN: ZDB-GENE-030918-4
Ensembl: ENSDARG00000063207
Vega: OTTDARG00000029803
UniProt: B8LFF6
LinkDB
Position
1
AA seq 1414 aa
MWPVRFLLLFCLVFTFAVLQRSSGQSVCPGTDNKLSTLSDLDQQYKTLRKFYENCEVVMG
NLEITSIERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTKLYEGRYSLAIFL
NYRRDGYFGLRQLGLRNLTEILNGGVYVDQNKFLCHADTIHWQDIIKNPRSELLVVPSNN
SGNTCRRCHRSCNGRCWGPQEDQCQSLTXTVCAEQCDGRCFGPYVSNCCHRECAGGCFGP
KDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDH
SSCVRACPSNKMEVEENQTKMCIPCTDICPKVCDGIGTGSLQMAQTVDSSNIEKFVNCTK
INGNLIFLITGIKGDMFHGIRALDPDRLNVFRTVREITGFLNVQSWPENMTDLGVFSNLA
TIGGRSLYSGISLLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFYSTVNWTSLFRTS
TQRALIKNNREPRECSKEQKICDPLCSEAGCWGPGPDQCLSCKYFSRGKTCVKSCNLYYG
DVREFANGSVCVECDSQCEKAGEKGLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGLQGAN
SFIFKYAETNNECHPCHPNCTQGCTGPRIQDCVGMLDRTPLIAAGLIGGLFVIVIIALSV
AVYIRRKSIKKKRALRRFLETELVEPLTPSGAAPNQAQLRILKETELKRVKILGAGAFGM
VYXGIWVPEGETVKIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPT
IQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMXLEERRLVHRXLAARNVLV
KSPNHIKITDFGLARLLDTDEKEYNSDGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIW
ELMTFGGXPYDGIPTRDIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELA
AEFSRMARDPQRYLVIQGDDRMKLPSPNHSTFFQSLLDEEELDDLMDADEYLVPQTCNIS
TSTYTSRTTMDASWTLRCRDRVFSPEDGMGACSRDVPASASAVFVPVSTQAAGLNVLEEQ
HCNGSLKKQQPMSGSGDDCDGQRYSADPTVFLGERSLKNTDEDGYMSPMNKSTSDHLSPV
EENPFVNHRKNGNITALDNPGYHSTPDRKSKAEEDEYINEPLYLNAYNTTGGTNLEIMRR
NGSSIPLQMTTATSAASSHIILSTQPGKAHHHGQGTHVHFAIPPVQPPQTRAMSQNGQHS
QSSHAVESNSSSMSANPSLLSQISLVSQQIQPCLASQSQVPKSTVPNKSISGLPGHLVYP
VNMLQTGHTGTVMADRKSKKNFDNPDYWQHSLPPKVTQANPQDPTQTCKSKHLYRHSIRS
RLAVADNPEFVSEFNKRPGPVLPPPPYRHRNTVV
NT seq 4245 nt   +upstreamnt  +downstreamnt
atgtggccggttcgcttccttctcctcttctgcctggtcttcacgtttgcggtgcttcag
aggagcagcgggcagtcagtgtgtcctggcactgataacaagctcagcacgctgtcggat
ttggaccagcagtacaagactcttcgcaagttttatgagaactgtgaggtggtcatgggt
aatctggagatcaccagtattgagaggaaccggaacctgtctttcctcaagtctatccgg
gaggtgacgggttacgtgttggtggctctaaaccagtttgactatcttcctcttgagaac
ctgcgaatcatccgaggcactaaactctacgaaggacgctactctctggccatctttctc
aactacagacgagacggctacttcggcctgagacagctcggcctcaggaacctgacagaa
atcctgaatggaggtgtgtatgtggatcagaataagttcttgtgtcatgcggacaccatc
cactggcaggacatcatcaaaaaccctcgatctgaacttctggttgtgccgtcgaacaat
agtgggaacacatgcagaaggtgccatcgctcctgtaacggccgctgctggggtcctcag
gaggatcagtgccagagcttgacgaanacggtgtgtgcggagcagtgtgatggtcgatgt
tttgggccatatgtcagtaactgctgtcatcgtgaatgtgcaggaggctgtttcggaccc
aaagacaccgactgcttcgcttgcaccaactttaatgacagtggcgcctgcgtgactcaa
tgtcctcaaccattcgtctacaatccaacgaccttccagctcgagcacaatcccaatgcc
aaatacacctatggagctttctgtgtcaagaaatgcccacataattttgttgtggaccac
agctcttgtgtcagagcctgtccgagcaacaagatggaggtggaggaaaatcagaccaag
atgtgcatcccctgcactgacatctgcccgaaagtgtgtgatggaataggaaccggcagt
cttcaaatggctcaaacagtcgattccagtaacattgagaagtttgtcaactgcaccaag
attaatggcaacctaatcttccttattacaggcatcaaaggggacatgtttcatggaatt
cgagctctggatcctgatcggttaaatgttttccgcaccgtcagagagatcacaggtttc
ttgaatgttcagtcctggccggagaacatgacggatcttggcgttttctcaaaccttgcc
accattggaggacggtctctttacagtggtatttctctgctgatcctaaagcagcgctgg
atcacatctctgcagtttcagtctctgagagagatcagcgccggtaacgtctacatgacc
aacaacagccagctctgcttctacagcacagtcaactggacatctctgtttcgcaccagc
acccagcgagccctgatcaaaaacaacagagagcccagagagtgctctaaagagcagaag
atatgtgatccactatgttcagaggctggatgttggggtcctggyccagaccagtgtctg
tcctgcaaatacttcagccgaggaaaaacttgtgtcaagtcctgtaacttgtattacggt
gatgttcgagagtttgccaacggctcggtgtgtgtggagtgtgacagccagtgtgaaaaa
gctggagagaaaggtttaacctgccatggcccgggtccagatcactgtgtgaagtgtctg
catctcaaagacgggcccaactgtgtggagaaatgccctgacggtctgcagggagcaaac
agctttatcttcaaatatgctgagaccaacaacgagtgccatccctgccaccccaactgc
acccaaggctgtactggaccccggatacaagactgtgttggcatgttggacaggactcct
ctgattgctgctggattaattgggggtctctttgtaatagtcatcatagctctcagtgtg
gctgtttacatccgccgaaagagcatcaagaaaaaaagagccttacgtcgattcctggaa
accgagttggtggagcccttgacgcccagcggtgcagcaccaaaccaggctcagctgcgc
atcttgaaggaaacggaactcaagagggtcaagattctgggagctggagcctttggcatg
gtctatragggaatctgggttccagaaggggaaacagtgaagattcctgtggccataaag
atactcaatgaaagcactggaccaaaagccaatgtggagttcatggatgaggcgctgatc
atggccagtatggagcatcctcatctggtgcgtcttttaggggtctgcttgagtcccact
attcagctggtcactcagctcatgccccacggctgcctgctggactacgttcatgaacac
caggacaacatcggctcacagctgctgctcaactggtgtgtgcagatcgcaaagggtatg
atgyatctggaggagagacggctggtgcacagggrtcttgcagctcgtaacgttctggtt
aaatctccaaaccacatcaagatcactgactttggcctcgctcgactgctggacactgat
gaaaargagtacaattcagatggagggaagatgcctatcaagtggatggcactggagtgc
attcattacagaaagttcacacatcagagtgatgtatggagttacggagtgactatctgg
gagctgatgacgtttggaggaargccttacgacgggattcccacacgggacattccagac
atcctggagaaaggcgaacgtttgcctcagccgcccatctgcaccattgacgtctacatg
gtcatggttaaatgctggatgattgatgctgatagtcgtccacgttttaaagaactcgct
gcagagttcagccgtatggcacgagacccgcagagatacctcgtcatacagggcgatgat
aggatgaagctgcccagcccaaaccacagcacattctttcagagtcttctagatgaggag
gagctggatgacctgatggacgctgatgagtacctggttcctcagacctgcaatatctct
acctctacttacacgtcacgcacaacaatggatgccagctggactctgaggtgtcgtgac
agggttttcagtcctgaagacgggatgggggcttgttctcgtgatgttcctgcttcagcg
agtgctgtgtttgttcctgtgagcactcaagctgcgggactgaacgttctagaggaacag
cactgtaacgggagcctgaagaagcagcagcccatgtcaggatcaggggatgactgcgat
ggccagcgctacagtgcagacccgaccgtctttctcggtgagaggagtctgaaaaacaca
gacgaagatggatacatgagccctatgaacaagtcaacctcagaccatctcagtcctgtc
gaggagaatcctttcgtaaaccatcggaaaaatggaaacattactgcactggacaacccg
ggttaccacagcacacctgacagaaaatccaaagccgaagaagacgaatacatcaacgaa
cccctttacctcaacgcatacaacaccaccggtgggacaaacctggagatcatgaggcga
aatggatcctccatccctctacagatgacaacagcgaccagcgccgcgagcagccacatt
atcctctccacacaaccaggaaaagcccatcaccacggccagggaacacatgttcatttc
gccatcccacctgttcaacccccccaaaccagagcgatgagccaaaacggccagcattcc
cagtcttcacacgccgtcgagtccaattcctcaagcatgtccgccaatccctctttatta
tcccaaatctctctcgtcagtcaacagatccaaccttgtctggcgagtcagtctcaagta
ccgaaatccacagtcccaaataaaagcatatccggccttcctggtcacctcgtttacccg
gttaacatgcttcaaacaggacacactgggactgtaatggctgataggaagtccaagaag
aatttcgataatcctgattattggcagcacagtttgcctccaaaggtgacccaagcgaac
cctcaagacccaacgcagacgtgcaaaagcaaacacctgtacagacacagcattcggagt
cgtttggccgtggctgataacccggagttcgtatcggagtttaataagagaccaggaccg
gttctgccacctccgccataccggcacaggaatacggttgtgtaa

KEGG   Danio rerio (zebrafish): 101885162
Entry
101885162         CDS       T01004                                 

Gene name
si:ch73-383l1.1
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101885162 (si:ch73-383l1.1)
   04012 ErbB signaling pathway
    101885162 (si:ch73-383l1.1)
   04020 Calcium signaling pathway
    101885162 (si:ch73-383l1.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    101885162 (si:ch73-383l1.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101885162 (si:ch73-383l1.1)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101885162 (si:ch73-383l1.1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH
Other DBs
NCBI-GeneID: 101885162
NCBI-ProteinID: XP_021331611
ZFIN: ZDB-GENE-121214-64
Ensembl: ENSDARG00000090408
LinkDB
Position
1
AA seq 1392 aa
MWPVRFLLLFCLVFTFAVLQRSSGQSVCPGTDNKLSTLSDLDQQYKTLRKFYENCEVVMG
NLEITSIERNRNLSFLKSIREVTGYVLVALNQFDYLPLENLRIIRGTKLYEGRYSLAIFL
NYRRDGYFGLRQLGLRNLTEILNGGVYVDQNKFLCHADTIHWQDIIKNPRSELLVVPSNN
SGNTCRRCHRSCNGRCWGPQEDQCQSLTKTVCAEQCDGRCFGPYVSNCCHRECAGGCFGP
KDTDCFACTNFNDSGACVTQCPQPFVYNPTTFQLEHNPNAKYTYGAFCVKKCPHNFVVDH
SSCVRACPSNKTEVEENNIKMCIQCTEICPKMCDGIGTGSLQSAQTVDSSNIEKFVNCTK
INGNLIFLITGIKGDMYHGIRALDPERLNVFRTVREITGYLNIQSWPENMTDLSVFSNLV
TIGGRTLYSGISLLILKQRWITSLQFQSLREISAGNVYMTNNSQLCFYSTVNWTSLFRTS
TQKAKIKDNRDPRECSQQRMVCDPLCSVSGCWGPGPNQCLSCKYFSRGRTCVRSCNLYNG
DVREFANGSTCVECDSQCEKAEDKSLTCHGPGPDHCVKCLHLKDGPNCVEKCPDGLQGAN
SFIFKYPETNNECHPCHPNCTQGCTGPRIQDCIGILDRTPLIAAGVIGGMFVVVIVALGF
AIFFRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKILGTGAFGT
VYKGIWVPEGETVKIPVAIKILNESTGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPT
IQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLV
KSPNHIKITDFGLARLLETNEKEYSADEGKMPIKWMALECIHYRKFTHQSDVWSYGVTIW
ELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELA
AEFSRMARDPQRYLVIQGDDRMKLPSPNHSKFFQSLLDEEELDDLMDADEYLVPHSLNAP
PTSHIPHPHVDSNQNQFGYHDGSRCPEDVTRFHEVAAAGNAPSALGSAQRAGLDLVEEQH
CNGSLKKQATVHSVEDSSGQRYSADPTVLLGEKTQREDTDEDGYMSPMKDKISTNHLNPV
EENPFVTRRKSKDVHALDNPGYHNTPDGKPKCEDEYINEPLYLNTFNNTSDIHQEMLRKN
GVSIPAQMTTAGHILQTGKPHHHSHGPHVHFAIPPVQPVHPGPMSQNDHNAHSVQSGHDH
AVKSGPSAGQICLVSHQVQQGHPSKSNRSPQQFQLSGGKLPGHPVQPGSQIGTVLVDKMY
KNSFDNPEYWQHSLPPPQISQDSSSAVCNNKFLYKQNGRVQPPAAENPEYLSGVKPGMVL
PPPPYRQRNTVV
NT seq 4179 nt   +upstreamnt  +downstreamnt
atgtggccggttcgcttccttctcctcttctgcctggtcttcacgtttgcggtgcttcag
aggagcagcgggcagtcagtgtgtcctggcactgataacaagctcagcacactgtcggat
ttggaccagcaatacaagactcttcgcaagttttatgagaactgtgaggtggtcatgggt
aatctggagatcaccagtattgagaggaaccggaacctgtctttcctcaagtctatccgg
gaggtgacgggttacgtgttggtggctctaaaccagtttgactatcttcctcttgagaac
ctgcgaataatccgaggcactaaactctacgaaggacgctactctctggccatctttctc
aactacagacgagacggctacttcggcctgagacagctcggcctcaggaacctgacagaa
atcctgaatggaggtgtgtatgtggatcagaataagttcttgtgtcatgcggacaccatc
cactggcaggacatcatcaaaaaccctcgatctgaacttctggttgtgccgtcgaacaat
agtgggaacacatgcagaaggtgccatcgctcctgtaacggccgctgctggggtcctcag
gaggatcagtgccagagcttgacgaagacggtgtgtgcggagcagtgtgacggtcgatgt
tttggaccgtatgtcagtaactgctgtcaccgtgaatgtgcagggggctgtttcggaccc
aaagacacagactgctttgcttgcaccaactttaatgacagtggtgcctgcgtgactcaa
tgtcctcaaccattcgtctacaatccaacgaccttccagctcgagcacaatcccaatgcc
aaatacacctatggagctttctgtgtcaagaaatgcccacataactttgtggtggatcac
agctcttgtgtcagagcctgtccgagcaacaagacggaggtggaggaaaataacatcaag
atgtgcatccagtgcactgaaatctgccccaaaatgtgtgatggtataggaaccggcagc
cttcaatcagcccaaactgttgattccagcaacattgagaagtttgtcaactgcaccaag
atcaacggcaacctcatcttcctcatcacaggcatcaaaggagacatgtatcatggcatc
agggctctggatccggagagactaaatgttttccgcaccgtcagagagatcacaggttac
ttgaacatccagtcttggcctgaaaacatgactgaccttagtgttttttccaaccttgtc
accataggaggaagaactctctacagtggtatttctctgctgatcctaaagcagcgctgg
atcacgtctctgcagtttcagtctctgagagagatcagcgctggtaacgtctacatgacc
aacaacagccagctttgcttctacagcacagtcaactggacgtctctgtttcgcaccagc
acacagaaagccaagatcaaggacaacagagaccccagagagtgctctcaacagaggatg
gtttgtgatccgctgtgctcagtgtcaggatgctgggggcccgggccaaatcagtgtctg
tcctgtaaatacttcagccggggaaggacatgtgtgaggtcctgtaatttgtataatgga
gatgttcgagaatttgccaatggatctacgtgtgtggagtgtgacagtcagtgtgaaaag
gctgaagataaatctctcacctgtcacgggcctggaccagatcactgtgtgaagtgtctg
catctcaaagacgggcccaactgtgtggagaaatgccctgacggtctgcagggagcaaac
agctttatcttcaaatatcccgagaccaacaacgagtgccatccctgccaccccaactgc
acgcaggggtgtactggaccccggatccaagattgtatcgggatactggacaggactcct
ctgattgcagctggggtgattggtgggatgtttgtggtcgtaattgtggctcttggattt
gccatctttttccgccgaaaaagcataaagaagaagagagctttacgacgtttcctagaa
actgagttggtggagcctttaacacccagtggcacggctcctaaccaggcacagttacgc
atactgaaggaaactgagctcaagagggtcaagatcttgggaactggagcatttggcact
gtttacaagggaatctgggttccagaaggggaaactgtgaagattcctgtggccataaag
atactcaatgaaagcacgggacctaaagccaatgtggagtttatggatgaggcgctgatc
atggccagtatggagcatcctcatctggtgcgtcttttaggggtctgcttgagtcccact
attcagctggtgactcagctcatgccccacggctgcctgctggactacgttcatgaacac
caggacaacatcggctcacagctgctgctcaactggtgtgtgcagatcgcaaagggtatg
atgtatctggaggagagacggctagtgcacagggatctcgcggctcgtaatgtgctggtt
aaatctccaaaccacatcaagatcactgattttggactcgctcgactgctggaaaccaat
gaaaaggagtacagtgcggatgaaggcaagatgcccatcaagtggatggctctggagtgt
attcactataggaagtttacacaccagagtgatgtatggagctacggagtgactatctgg
gagctgatgacatttggaggaaagccttacgacgggattcccacacgggagattccagac
atcctggagaaaggcgagcgtttgcctcagccgcccatctgcaccatagatgtctacatg
gtcatggtcaaatgctggatgattgatgccgatagtcgtccacgttttaaagaactggcc
gcagagttcagccgtatggcccgagacccgcagagatacctcgtcatacagggagatgat
aggatgaagctgcccagcccaaaccatagcaagttcttccagagtcttctagatgaggag
gagctggacgacctgatggacgctgacgagtacctggttcctcattccctaaatgcccct
cctacttcccatataccacacccacatgtagattcaaatcagaatcagtttgggtatcat
gatggaagtcggtgtcctgaggacgtaacgaggtttcatgaagtggctgctgctggaaac
gcaccctctgctcttggaagtgcacaaagagcaggtctggatctggtggaggagcaacac
tgtaatggcagcttgaagaaacaggccacggttcattcagtggaggacagcagtggccaa
cgttacagcgcagaccccactgtcctgctgggagagaaaacacagagagaggatacagat
gaggatgggtacatgtcccctatgaaggacaagatctccacaaatcatttgaatccagtt
gaggagaatcctttcgtaacaagacgcaaaagcaaagacgttcatgcattggacaacccg
ggttaccacaacacccctgacggaaagcccaaatgtgaagacgagtacattaacgagccc
ctttacctcaacacgttcaacaacaccagcgacatccaccaggagatgctacggaagaac
ggagtctccatcccagcacagatgaccacagctggccacatcttacagacgggtaaaccc
catcaccacagccatgggccgcatgttcacttcgccatacctccagtccagccggtgcac
cctggacccatgagccaaaatgatcacaatgcacattcagttcagtcaggccacgatcac
gccgtcaaatccggcccatcagcaggtcagatctgtctagtgagccatcaagtccaacag
ggacatccgagcaaatccaaccgttcaccacaacagtttcaattatcaggaggtaaacta
ccaggtcatccagtgcagccaggcagccagattgggactgtattagtggacaagatgtac
aagaacagctttgacaatccggagtattggcagcacagccttcctccacctcaaatctcc
caggactcttcttctgcggtctgcaataacaagttcctttacaagcagaatggccgcgtt
cagcctcctgcggcagaaaaccctgaatatctgtctggtgtgaagccgggaatggtcctg
ccgcctcctccgtaccggcagaggaacactgtggtctaa

KEGG   Danio rerio (zebrafish): 569836
Entry
569836            CDS       T01004                                 

Gene name
erbb4b
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    569836 (erbb4b)
   04012 ErbB signaling pathway
    569836 (erbb4b)
   04020 Calcium signaling pathway
    569836 (erbb4b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    569836 (erbb4b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     569836 (erbb4b)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   569836 (erbb4b)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 569836
NCBI-ProteinID: XP_009303149
ZFIN: ZDB-GENE-030918-5
LinkDB
Position
9
AA seq 1374 aa
MKLASSLCCLGFLLTSVAVRLSDSQQVCTGTENKLSTLSDLDQQYRTLRKYYENCEVVMG
NLEITSIDRSRDLSFLRSIREVTGYVLVALNQFEYLPLENLRIIRGTRLYEDRYALAIFL
NYRRDGNFGLRQLGLKNLTEILNGGVYVDQNKFLCHADTIHWQDIVKNARPDHLVVPSNS
SSSCQRCHRACNGRCWGPKEDQCQSLTKTVCAEQCDGRCFGPYVSDCCHPECAGGCSGPK
NTDCFACTNFNDSGACVTQCPRPFVYNPTTFQLEHNPWAKYTYGAFCVKKCPHNFVVDHS
SCVRACPSNKMEVEENRIKMCIPCTDICPKACDGIGTASLQTAQTVDSSNIDRFINCTKI
NGNLVFLITGIKGDVYHNIEPLDPEKLNVFRTVREITGFLNIQSWPENMTDLSVFSNLAT
IGGRALYSGISLLVLKQQWITSMQLQSLREISAGNVYVTNNSQLCYYNTVNWTRLFRINT
QKALIRNNRDPKECILDRMVCDPLCSDAGCWGPGPDQCLSCRFFIRGRTCVESCNLHEGD
VREFANGSVCLECDAQCEVPEDDALTCTGPGPDHCVKCRHFKDGPNCVEKCPDGLQGASS
FIFKYAEANNECHPCHVNCTQGCTGPRLQDCIGVMDRTPLIAAGVIGGLFVVIIIGLSVA
ISVRRKSIKKKRALRRFLETELVEPLTPSGAAPNQAQLRILKETELKRVKILGAGAFGTV
YKGIWVPEGETVKIPVAIKILNEATGPKANVEFMDEALIMASMEHPHLVRLLGVCLSPTI
QLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVK
SPNHIKITDFGLARLLDANEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWE
LMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAA
EFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQSLLDEEELEDLMDAEEYLVPQAYSIPP
LAYTTRSRMDPNRNQFAYQDGSFGMEDMMATIPRVVAVSAVSPGCSTQKQSKGQQGASGS
SEAFEDSRCNGTLRKKASPRASTGDDSSGQRYSADPTVILCEHGARAETDQDGYMSAMQD
KKPSDFLNPVEENPFVTHRRNGEVHTLERGYHSTSNGQPKLEDEYVNDPLYLNTFHNTGE
KSHDALRKNGVPVVHTAAAAAATVAAANTITANNHTLSQTMQPAASSAHITTQPLYQGKP
SISTLSGHTLHSAHPGHALHPTHTLHPAHTGTIKADLKAKKTFDSPEYWQHSLPPKATLH
NPEYLQDCSTRFFYRQNGRIRPAVAENQEYLSDYALKPGTVLPPPPYRQRNTVV
NT seq 4125 nt   +upstreamnt  +downstreamnt
atgaagctggcatcttctctgtgttgcctcgggtttcttctcacttctgtggcggtccgt
ctgagcgactcgcagcaagtatgcactggcacagaaaataaactgagcactctgtcagat
ctggaccagcagtatcggacccttcgtaaatactatgagaactgtgaggtggtgatgggg
aatctggagatcaccagcattgatcgcagccgtgacctgtcttttcttaggtccattcgt
gaggtgactggctatgtgctcgtggcactgaatcagtttgaatatcttcccctggagaat
cttcgcatcatccgtggcaccaggctgtatgaagaccgatatgctctggcaatcttcctc
aactaccgcagagacggaaactttggcctccgtcagcttggccttaagaacctcacagaa
atcctgaatggaggggtgtatgtggaccagaacaaattcctgtgtcatgctgataccatc
cactggcaggacatagtgaagaatgctcgccctgatcacctggttgtgccatccaacagc
agcagctcctgtcagaggtgtcacagagcatgtaatggacgctgctgggggcctaaggaa
gaccagtgtcaaagcttgacgaagacggtgtgcgcggagcagtgtgatggccgctgtttt
gggccgtacgtcagtgactgttgccatcctgaatgtgctggaggctgttctggaccaaaa
aacacagactgcttcgcttgcacaaacttcaacgacagcggcgcttgtgtgacccaatgc
ccacggcccttcgtctacaaccccaccacgttccagctggagcacaacccatgggccaaa
tacacatacggagcattctgcgtcaaaaagtgcccacataactttgtggtggaccacagc
tcctgtgtcagagcctgtcccagcaataagatggaggtggaggagaacaggatcaagatg
tgcatcccctgcactgatatctgccccaaagcatgtgatgggatcggcactgccagcctt
cagacggcgcaaactgtcgactccagcaacatcgacagattcatcaactgcacaaagatc
aacggaaacctggtgttcctcatcacaggcattaaaggggatgtttaccacaacatagaa
cctctggatccagagaaactcaacgtgtttcgcactgttcgagagatcactggttttctg
aacattcagtcttggcctgaaaacatgactgatctgagtgtcttctccaatctggcaact
attggaggcagagctctctacagtggcatctctcttctagtgctgaagcaacagtggatt
acctcaatgcagctgcagtctctcagagagatcagtgctggaaatgtgtatgtcaccaac
aacagtcaactctgctactataacactgtcaactggacacgactcttccgcatcaacacc
cagaaggccctgatccgcaacaaccgtgaccccaaggaatgcattttggaccgaatggta
tgtgacccgttgtgctctgacgctggatgctggggtccggggcctgaccagtgcctgtcc
tgccgcttcttcatcaggggacgcacctgtgtcgaatcttgcaacctgcacgaaggggac
gtgcgtgagtttgctaatggctcggtgtgtctggagtgtgatgcacagtgtgaagtgccg
gaggatgatgctcttacctgcactggacctggtcctgatcactgtgttaaatgtcgtcac
tttaaagacggacccaactgtgtggagaaatgccctgacggtctacagggagcgagcagc
ttcatcttcaaatacgctgaggccaacaatgagtgtcacccctgccatgtcaactgcacc
cagggatgcacagggccccgtctgcaggactgcatcggcgtgatggacaggactcccctt
attgcggcaggggttattggaggattgtttgtggtgatcatcataggtcttagtgttgcc
atatcagtgaggaggaaaagcatcaagaagaagagagcattgaggcgcttcttggagacc
gagttggtggagcctttgacccccagcggtgcagccccaaatcaggcccaactgcgcatt
ctgaaagagacggagctgaaacgggtgaagatcctgggagccggagcctttggcactgtc
tacaagggcatctgggttcctgagggtgagactgtgaagattcctgttgccattaagatc
ttgaacgaagcgacaggccccaaagccaatgtggaattcatggatgaggctctgatcatg
gccagcatggaacatcctcacctggtgcggttattaggtgtttgtctgagtcccaccata
cagctggtcactcagctcatgccccacggctgtctgctggactacgtgcacgaacacaaa
gacaacatcggctcccaattactgctcaactggtgtgttcagatcgcaaagggtatgatg
tacttggaggagcgtagactcgtgcacagggacctggctgctcgaaacgtcctagtaaag
tcacctaaccacatcaagatcactgacttcggtctggctcgccttctggatgcaaacgag
aaggaatacaatgcagacggaggcaagatgcctattaaatggatggccttggagtgcatc
cactataggaaattcacccaccagagtgacgtatggagttacggagtcactatatgggag
ctgatgacatttggaggaaagccgtatgatggaattcctacccgagagatcccagacctg
ctggagaaaggagagaggcttcctcagcctcccatctgcactattgacgtctacatggtc
atggtcaagtgctggatgatagatgcagacagcagacccagatttaaggagcttgcagca
gagttcagccggatggcaagagacccacaacgttacctagtcatccagggggatgaccgt
atgaagctgccgagtcccaacgacagtaagttcttccagagcctgctagatgaagaggaa
ctggaggatctgatggatgccgaggagtatttagtgccacaagcttacagtattcctcca
ttggcatacacaactagatcccgcatggatcctaacagaaaccagttcgcctatcaggac
ggcagctttggcatggaggacatgatggccactatcccgcgggttgtggctgtgtctgca
gtcagtccaggctgctccactcagaagcaatcgaagggccaacagggggcctcaggctcc
tctgaggcgtttgaagacagccgctgtaatggcactctcaggaagaaggcttcacccagg
gcgagcactggggacgacagcagcggccaacgctacagtgcagatcccacggtgatactg
tgtgagcatggagcaagagccgaaaccgaccaggatggatacatgagcgccatgcaggac
aaaaagccctcagattttctcaatcctgtggaggaaaaccccttcgtcacccatcgcaga
aatggagaggtccacactttggagcgaggctaccacagcacctccaatgggcagcccaag
ttggaggatgagtacgttaacgacccgctgtacctcaacacctttcataacactggggag
aagagtcatgatgctttaaggaagaacggagtccctgtggtgcacacagctgcggcagca
gcagcaacagtagcagcagcgaataccatcacagccaacaaccataccctttcccaaacc
atgcagccagctgcatccagtgcccacatcacaacacagcccctctaccaaggcaaacca
agcatctccaccctctctggccacactcttcactccgcccatcctggacacgctcttcac
ccaacgcacactctccatcctgctcacaccggaaccatcaaggccgacttaaaggccaaa
aagacatttgacagtcctgagtactggcagcacagtcttccccctaaggctactcttcac
aacccggagtatctgcaggactgcagcacacgctttttctaccggcaaaatggtcgaatc
cgacctgcggtggccgagaaccaggagtatctgtctgattatgcgctaaaaccgggtact
gtgttgccaccgcctccataccgccagaggaacactgttgtgtag

DBGET integrated database retrieval system