KEGG   Danio rerio (zebrafish): 100034402
Entry
100034402         CDS       T01004                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha precursor
  KO
K08774  transforming growth factor, alpha
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100034402 (tgfa)
   04012 ErbB signaling pathway
    100034402 (tgfa)
SSDB
Motif
Pfam: EGF Laminin_EGF SSP160 FSA_C Mucin
Other DBs
NCBI-GeneID: 100034402
NCBI-ProteinID: NP_001137524
ZFIN: ZDB-GENE-040724-208
Ensembl: ENSDARG00000053939
Vega: OTTDARG00000002188
UniProt: Q7T011
LinkDB
Position
6
AA seq 191 aa
MMYRAFWDTIFLLTGSLFTYGQVQENSTSTTTIATTTTTTTTTTTTTTTSTTTTTTTTRV
RKFIAAAVHSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHPGFVGMRCEHADLLAVVA
SNHRQQTVATMLVFCWWRRGGCGRGHTLSCWTEKPRSILTSGTSCCNSETGIPVLHFHFY
TIFMLSCTVVC
NT seq 576 nt   +upstreamnt  +downstreamnt
atgatgtatcgtgctttttgggatacaatattccttctcaccggctccctttttacgtat
gggcaggtgcaagagaattctacctcaacgacgactattgcaaccacgacaacaactact
acaacaactaccaccactaccaccaccagcaccacgaccaccactactaccacacgagtc
agaaaatttatagcagctgcagtccactctcactttgatgactgtcccgactcccacagc
cacttctgttttcatggcacatgtcgttttctcatcctggaggaaacacctgcatgtgta
tgccatcctggctttgtgggcatgcggtgtgaacatgcagatctcctagcagtggtggca
tcaaaccaccggcagcagaccgtggccaccatgctggtgttttgttggtggagacggggt
ggttgtgggcgaggtcacaccctctcctgttggacggagaagcctaggagtattttgacg
agtgggacatcctgctgtaactcagaaacaggtattccggtgctacatttccatttttac
accatttttatgctgagctgtacggtcgtgtgttaa

DBGET integrated database retrieval system