KEGG   Danio rerio (zebrafish): 100038790Help
Entry
100038790         CDS       T01004                                 

Gene name
zgc:163121
Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00250  Alanine, aspartate and glutamate metabolism
dre00410  beta-Alanine metabolism
dre00430  Taurine and hypotaurine metabolism
dre00650  Butanoate metabolism
dre01100  Metabolic pathways
Module
dre_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100038790 (zgc:163121)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100038790 (zgc:163121)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100038790 (zgc:163121)
   00430 Taurine and hypotaurine metabolism
    100038790 (zgc:163121)
Enzymes [BR:dre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100038790 (zgc:163121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SHMT DegT_DnrJ_EryC1 SepSecS
Motif
Other DBs
NCBI-GeneID: 100038790
NCBI-ProteinID: NP_001083039
ZFIN: ZDB-GENE-070424-80
Ensembl: ENSDARG00000055370
Vega: OTTDARG00000023889
UniProt: B0V1P2
LinkDB All DBs
Position
2
AA seq 546 aa AA seqDB search
MTRSPESIMDFTQADRRHLDKSKQDTSSLENTDDGLKYDSGRVTHDFSCIHSKDLLPAED
GEEATKHFLQELVNILLAYISKSLKRSTKVLDFHYPHQLNEGLEGFSLELPDQPDNLEQL
LVDCRDTLKYGVKTGHPRFFNQLSTGLDIVGLAGEWLTSTANTNMFTYEISPVFILMEEV
VLRKMHTIIGWPEEDGDGIFCPGGSMSNLYSVLLARFHLFPAVKTHGMCAIPRLAMFTSA
HSHYSIKKSAAVLGIGTENVIVVRCDERGKMISSELNSSIEEAKSKGLVPFYVNATAGTT
VYGAFDPLHKIADICEHHGLWMHVDAAWGGGLLLSNKHRVKLHGIERAHSVTWNPHKMMG
VPLQCSTILVKRKGLLQQCNQLCAEYLFQPDKHYEVSYDTGDKSIQCGRHVDIFKLWLMW
KAKGSEGFESQVNHCLENAEYLYYKLKRRTDFQLVFKGKPEHSNVCFWYLPKRVQNIPLG
PEREKELHMVAPKIKTKMMEEGFTMIGYQPLEDKVNFFRCVFSNPATQREDVDFLLDEIV
RLGCEL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggtctccagaaagcattatggatttcacacaagctgacaggcggcatttagac
aagagcaaacaggacaccagctctttagaaaacacagatgatggcctgaaatatgatagt
gggcgcgtaactcacgacttcagctgcatccacagcaaagatctgctccctgctgaagac
ggggaggaagcaaccaagcacttcctgcaggagcttgtaaacatattgctggcctacatc
agtaaatccctgaaacgcagcacaaaagttttggatttccactatcctcaccagctcaat
gaaggtctggagggcttcagcctggagcttcctgaccagccggataatctggaacagctg
ctggtggactgcagggacacactgaaatacggcgtcaaaacaggtcatccaagatttttt
aaccaactgtcaactggacttgacatcgttggtctggcaggagaatggttgacatccact
gcaaatacaaacatgtttacttatgaaatatccccagtcttcatcctaatggaggaggta
gttctcagaaaaatgcacacaattattggatggccagaggaagatggagatggcatcttt
tgtcctggaggctccatgtccaatctctacagtgtgttgttggctaggtttcatctcttt
ccggcagtgaagacccacgggatgtgtgcgatccctcgcctagcgatgttcacctccgcg
cacagtcattattcaatcaagaagtctgcggctgttctcggcatcggcactgaaaatgtg
atagtcgtcagatgtgacgaaagggggaagatgatctcatcagaactcaactccagcatt
gaggaagcaaagtcgaagggcctcgtcccattctatgtcaacgcaaccgccggaactaca
gtctatggagcctttgaccctttgcataaaatagcagatatttgtgagcaccatggcctc
tggatgcacgtagatgctgcttggggtggaggcttgcttctatccaacaaacaccgcgtg
aaactgcacggaattgaaagagcccattctgtgacctggaacccacacaagatgatgggc
gttccactgcaatgctccaccattctagtcaagaggaagggcctcctgcagcagtgtaat
cagctgtgtgccgaatatctcttccaacctgacaagcactacgaagtgtcctacgacact
ggggacaaaagcattcagtgcggacgacacgtggatatctttaaactgtggctcatgtgg
aaggcgaagggctccgagggttttgaatcacaggtcaaccactgcctggagaatgcagag
tatctttactacaagctgaagagaagaacagattttcagctcgtcttcaagggaaaacct
gaacacagtaatgtgtgcttttggtatctccccaaacgagtgcaaaacattcctctaggc
ccagagcgagagaaagaacttcatatggtggctccgaagatcaagacaaagatgatggag
gaaggattcaccatgattggctatcagcctttggaagacaaagtgaatttcttccgttgc
gttttctccaacccagcgacacagagggaagacgtcgacttcctgctggatgaaatcgtc
cgtctgggctgtgaactctag

DBGET integrated database retrieval system