KEGG   Danio rerio (zebrafish): 100148828Help
Entry
100148828         CDS       T01004                                 

Gene name
b4galt2
Definition
(RefSeq) beta-1,4-galactosyltransferase 2
  KO
K07967  beta-1,4-galactosyltransferase 2 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00052  Galactose metabolism
dre00510  N-Glycan biosynthesis
dre00513  Various types of N-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre00515  Mannose type O-glycan biosynthesis
dre00533  Glycosaminoglycan biosynthesis - keratan sulfate
dre00601  Glycosphingolipid biosynthesis - lacto and neolacto series
dre01100  Metabolic pathways
Module
dre_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
dre_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100148828 (b4galt2)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100148828 (b4galt2)
   00513 Various types of N-glycan biosynthesis
    100148828 (b4galt2)
   00515 Mannose type O-glycan biosynthesis
    100148828 (b4galt2)
   00514 Other types of O-glycan biosynthesis
    100148828 (b4galt2)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    100148828 (b4galt2)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100148828 (b4galt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100148828 (b4galt2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     100148828 (b4galt2)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     100148828 (b4galt2)
    2.4.1.90  N-acetyllactosamine synthase
     100148828 (b4galt2)
    2.4.1.-  
     100148828 (b4galt2)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   100148828 (b4galt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 100148828
NCBI-ProteinID: NP_001121857
ZFIN: ZDB-GENE-070912-258
Ensembl: ENSDARG00000077994
Vega: OTTDARG00000024935
UniProt: A8WHZ0
LinkDB All DBs
Position
2
AA seq 379 aa AA seqDB search
MSRLMLGRTLERICKAVLLLCLVHFLIMMILYFDVYSQRFDIFSRFNNGRGANNSRGAHH
YYYNFSSGRPNTTFASYLATADHLLPSTKPEANHTPPTPKPLPPCPEVPLGLVGRLLIEF
SSQITLERVQRENPNVTEGGKYTPPDCRPKQKVAIIIPFRHRDNHLKYWLHYLHPVLRRQ
KIDYGIYIINQLGEDTFNRAKLLNVGYTEAIKDAEYNCFIFSDVDLIPMDDRNLYHCYDQ
PRHFAIAMDKFGFRLPYAGYFGGVSGLSKKQFLKINGFPNEYWGWGGEDDDIYNRITLNG
MKVSRPDVRIGRYRMIKHERDKHNEPNPQRFSKIQNTKNTMRKDGISSLMYRVVSIKKYP
LYTNISVEIGKPPPRPLKG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctgatgttgggccggaccctggagcggatttgcaaggctgtgctgttgctc
tgcctggtgcacttcctcatcatgatgatcctctacttcgatgtctacagccagcgtttc
gacatcttcagccgcttcaacaatggccgtggagcaaataactctcgaggagcccaccac
tattactacaatttctccagcggaaggcccaacactacctttgcgagctacttggccaca
gctgaccatcttctgcctagcaccaagccagaggcaaaccacacaccgccaaccccaaaa
ccattaccaccatgtccagaggtccctcttggtcttgtgggccgtctcctcatcgagttc
agctcccagataaccctggagcgggtgcagagggagaacccgaatgtcacagaaggcggg
aaatatactcctccggactgccggccaaaacaaaaggtggccatcatcatccctttcagg
cacagagacaaccatctgaaatactggcttcactatttgcatccagtcctgcgcagacag
aagatcgactatgggatctatatcatcaaccagctgggtgaggacacctttaatcgggcc
aagctgctgaatgttggctacacagaggctattaaagacgcagaatacaactgcttcatt
ttcagtgacgtggacctgatccctatggatgacagaaacctctaccactgttacgaccag
ccccgtcactttgccattgccatggacaaatttggcttcagattgccctatgcaggttat
tttggaggggtgtccggccttagcaaaaaacaattcctcaaaatcaatggcttccctaat
gagtactggggatggggaggtgaagatgatgacatttacaacagaatcacactcaatggg
atgaaagtgtctcggcccgacgtgagaatcggccgctacaggatgatcaagcatgagaga
gacaagcacaatgagccaaacccccagaggttcagtaagatccagaacaccaagaacacc
atgagaaaagatggcatcagctcgctcatgtatagagtggtctccataaagaagtacccg
ctctacaccaacatttcagtagagatcggcaagcctcctccaagacccctcaaaggatag

KEGG   Danio rerio (zebrafish): 550425Help
Entry
550425            CDS       T01004                                 

Gene name
b4galt1
Definition
(RefSeq) beta-1,4-galactosyltransferase 1
  KO
K07966  beta-1,4-galactosyltransferase 1 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00052  Galactose metabolism
dre00510  N-Glycan biosynthesis
dre00513  Various types of N-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre00515  Mannose type O-glycan biosynthesis
dre00533  Glycosaminoglycan biosynthesis - keratan sulfate
dre00601  Glycosphingolipid biosynthesis - lacto and neolacto series
dre01100  Metabolic pathways
Module
dre_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
dre_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    550425 (b4galt1)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    550425 (b4galt1)
   00513 Various types of N-glycan biosynthesis
    550425 (b4galt1)
   00515 Mannose type O-glycan biosynthesis
    550425 (b4galt1)
   00514 Other types of O-glycan biosynthesis
    550425 (b4galt1)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    550425 (b4galt1)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    550425 (b4galt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    550425 (b4galt1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    550425 (b4galt1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    550425 (b4galt1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     550425 (b4galt1)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     550425 (b4galt1)
    2.4.1.90  N-acetyllactosamine synthase
     550425 (b4galt1)
    2.4.1.-  
     550425 (b4galt1)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   550425 (b4galt1)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    550425 (b4galt1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   550425 (b4galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Amnionless
Motif
Other DBs
NCBI-GeneID: 550425
NCBI-ProteinID: NP_001017730
ZFIN: ZDB-GENE-050417-236
UniProt: Q567N4
LinkDB All DBs
Position
1
AA seq 214 aa AA seqDB search
MSESVGFFTKACVVLVLLCGLHLIVALIFYLSESPLAKFRNYRHISFISDMVNSQTHGEL
GQADNETLDVAVYKRIYNNETVIIGDVEKPAEVLESCPETSPLLVGQLRVEFSTPVDFNL
VRQGNKHLTMGGRYTPTKCVALQKVAMITPYRNREEHLKYWLYYLHPILKRQLLDYGIYI
IEQDGENTPNKTLKSLTICILGLSLRISVTLMVE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagtcggtgggattcttcactaaagcatgcgtcgtgctcgtgctgctctgcggg
cttcacctcatcgtggcactgattttctatttatcagagtcgcctttagctaaatttagg
aattatcgacacatttcatttatctctgatatggttaattcacaaactcacggagaattg
ggacaggctgacaatgaaacacttgacgtagctgtatataaacgtatctataataacgag
actgtcattattggtgacgtagagaaacctgcagaagtactggagtcgtgtcctgaaacg
tcgccacttttggtgggtcaactgcgagttgaattttcgaccccggtggattttaatttg
gtgcgtcaaggcaataagcatctgacgatgggcggcaggtatacacccaccaaatgtgtg
gctctgcaaaaagtggcgatgatcaccccatacagaaacagagaagaacacctcaaatac
tggctttactaccttcaccctatcttaaagagacagctgctggattatgggatttatatc
atagaacaggatggagagaacactccaaacaaaactctaaaatcgctgacaatatgcatc
cttgggttgagtttgagaatttcggttacactgatggtagaataa

KEGG   Danio rerio (zebrafish): 556544Help
Entry
556544            CDS       T01004                                 

Gene name
si:dkey-199f5.8
Definition
(RefSeq) beta-1,4-galactosyltransferase 3
  KO
K07968  beta-1,4-galactosyltransferase 3 [EC:2.4.1.90 2.4.1.38 2.4.1.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00510  N-Glycan biosynthesis
dre00513  Various types of N-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre00515  Mannose type O-glycan biosynthesis
dre00533  Glycosaminoglycan biosynthesis - keratan sulfate
dre00601  Glycosphingolipid biosynthesis - lacto and neolacto series
dre01100  Metabolic pathways
Module
dre_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
dre_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    556544 (si:dkey-199f5.8)
   00513 Various types of N-glycan biosynthesis
    556544 (si:dkey-199f5.8)
   00515 Mannose type O-glycan biosynthesis
    556544 (si:dkey-199f5.8)
   00514 Other types of O-glycan biosynthesis
    556544 (si:dkey-199f5.8)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    556544 (si:dkey-199f5.8)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    556544 (si:dkey-199f5.8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    556544 (si:dkey-199f5.8)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     556544 (si:dkey-199f5.8)
    2.4.1.90  N-acetyllactosamine synthase
     556544 (si:dkey-199f5.8)
    2.4.1.-  
     556544 (si:dkey-199f5.8)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   556544 (si:dkey-199f5.8)
  Glycolipid
   556544 (si:dkey-199f5.8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 556544
NCBI-ProteinID: XP_021328708
ZFIN: ZDB-GENE-030131-4733
Ensembl: ENSDARG00000018853
Vega: OTTDARG00000033586
LinkDB All DBs
Position
16
AA seq 390 aa AA seqDB search
MRSPIEFSSSNSSKLKSLSFDSQWCTTSLSVIMFTLQTKWRYLIMFLGVQLVVMALLSRE
GYQKRVSYFFRIFRKPDSSAGSMIGGRNHTDVYANLSRLGPPINRDDMPYCPKQSPHLVG
PIHVTFPSGLTLADVERKNPLVVRGGRYRPPNCEARHRTAIIIPHRSREHHLKFLLYYLH
PFLQRQQLNYGIYIIHQAGNYTFNRAKLMNVGFREAMRDEDWDCLFFHDVDLIPEDDRNT
YICDAHPKHAAIAMDKFGYKLPYKMYFGGVSALSPDQYLKMNGFPNNYWGWGGEDDDIGV
RVSLGGMVISRPSINVGRYKMIKHKHDKGNEVNPKRFNMLAKTRHTWKEDGMNTVEYEII
SRDYQPLYANITVNIGTEAGLHPTKNKPAS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagatcaccaatagagttcagttcctcaaattcatccaaacttaaatcactctcattt
gactctcagtggtgcactactagcttgagtgtcatcatgttcacgctgcaaaccaaatgg
cgttacttgatcatgtttttaggcgtccagttagtggtcatggctcttctgtcaagagaa
ggctatcagaaaagagtgtcgtattttttccggatattccgaaagccggattcttcggca
ggaagcatgattgggggacgcaaccatacagatgtctacgccaacctttcccggttaggc
cctcctattaatagagatgacatgccctactgccccaagcaatctccacacctagttgga
ccaattcatgtcactttcccttccgggctcacacttgccgatgtggagaggaagaaccca
cttgttgtccgtggaggtcgctataggccgcccaactgtgaggctcgccaccgcaccgca
ataatcattcctcacagaagccgggagcaccatctcaagttcctcctctactatctgcac
cccttcctacagcgccagcagctcaactatggcatctatatcattcaccaggctggtaat
tacacctttaaccgagcgaagctgatgaacgtgggctttcgtgaggccatgagggatgag
gactgggactgtctcttctttcatgacgtggacctcattccagaggacgaccgcaacacc
tacatctgcgacgctcaccctaaacacgctgccatcgccatggacaaatttggctacaag
ttgccttataagatgtattttggtggagtgtcggctctgagtcctgatcaatacctcaag
atgaacggcttcccgaataattactggggctggggtggagaagatgacgacattggcgtc
cgggtttcgcttggaggaatggtgatcagccgaccatccatcaacgtgggtcgatataag
atgatcaaacacaagcacgacaaaggcaatgaagtgaatcccaaaaggtttaacatgttg
gccaagacccgtcatacgtggaaagaagacggcatgaatacagtggagtatgagatcata
tcccgggattaccaacccctctacgccaacatcacagtcaacatcggcacagaggcaggc
ctgcacccgaccaaaaataaaccagcttcctaa

KEGG   Danio rerio (zebrafish): 561756Help
Entry
561756            CDS       T01004                                 

Gene name
b4galt3
Definition
(RefSeq) beta-1,4-galactosyltransferase 3 isoform X1
  KO
K07968  beta-1,4-galactosyltransferase 3 [EC:2.4.1.90 2.4.1.38 2.4.1.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00510  N-Glycan biosynthesis
dre00513  Various types of N-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre00515  Mannose type O-glycan biosynthesis
dre00533  Glycosaminoglycan biosynthesis - keratan sulfate
dre00601  Glycosphingolipid biosynthesis - lacto and neolacto series
dre01100  Metabolic pathways
Module
dre_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
dre_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    561756 (b4galt3)
   00513 Various types of N-glycan biosynthesis
    561756 (b4galt3)
   00515 Mannose type O-glycan biosynthesis
    561756 (b4galt3)
   00514 Other types of O-glycan biosynthesis
    561756 (b4galt3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    561756 (b4galt3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    561756 (b4galt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    561756 (b4galt3)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     561756 (b4galt3)
    2.4.1.90  N-acetyllactosamine synthase
     561756 (b4galt3)
    2.4.1.-  
     561756 (b4galt3)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   561756 (b4galt3)
  Glycolipid
   561756 (b4galt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 561756
NCBI-ProteinID: XP_009295048
ZFIN: ZDB-GENE-110624-1
Ensembl: ENSDARG00000062329
Vega: OTTDARG00000030642
LinkDB All DBs
Position
23
AA seq 416 aa AA seqDB search
MMVCCGRALDSPCTLALLVGFQFAFVLYFSLGGFRGLVSVLLHSTEPEIDYSRPHDVYTN
LTSLLLHHPGPSGAEQQLRDCSLPSPLLVGPVSVHLSSPPSLEEIKEKNPLVTLGGHYRP
PDCEPRHHTAIVVPYRNRQSHLRTLLYHLHPFLQRQQLHYAIYIVHQSGNSTFNRAKLLN
VGVREVLKEEDWSCIFLHDVDLLPENDHNTYTCHPQNPTHLSVAMDKFRYRLPYSQYFGG
VSAVTPQQYLKMNGFPNQYWGWGGEDDDIAARPRRDQVRLSGMKIMRPPLAIGHYKMIKH
KGDQGNEQNPRRFDLLKRTRLNWRSDGLNSLTYELLSKKLEPLYTNLSVNIGDDPHHPPG
KTPPRRVDPPLTSPNKTKTEKVGVVIANATKVEPALLKASNDSSNIVQKASLNQAG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatggtttgctgcggtcgagccctggactccccctgcactctggctctgttggtgggc
ttccagtttgcgttcgtcctctacttctcattgggaggattccgtggcctggtgtctgtt
ttgcttcactccaccgagcctgagattgactactctcggccacatgacgtttacaccaac
ctcacctctctgctgcttcaccatcccggccccagcggagcagaacagcagctcagggac
tgttcactgccctcgccactactggtgggtcctgtttctgtccacctctcatcacccccg
tccctggaggagatcaaagagaagaacccgctggtgaccttagggggacattaccgcccg
cctgactgtgagccgcggcaccacactgccattgtggtgccttaccgaaaccggcagagc
cacctccgcaccctcctctaccatctgcaccccttcctgcagcgacagcagctccactac
gccatttacatcgtccaccagtcagggaactccacctttaaccgagcgaagctgctgaat
gttggagtgcgtgaggtgctgaaagaggaggactggagctgtattttcctgcatgatgtt
gacctgctgcctgagaatgaccacaatacctacacctgccatccccagaaccccacacac
ctctctgtggccatggacaagttcagatacaggctcccatactcccaatacttcggaggg
gtttctgctgtaaccccgcagcagtacctcaaaatgaacggctttccgaaccagtactgg
ggctggggaggcgaggacgatgacatcgctgctcgccccaggagggaccaagttcgtctc
tcggggatgaagataatgcgtcctcctttggccattggtcattataagatgatcaaacat
aaaggcgatcagggtaatgagcaaaaccccagaaggtttgacttgctgaagcgcacaagg
ctgaactggcgctcagatggcctcaactcactaacttatgagctcctgtccaaaaagctt
gagccactctacaccaatctatcagtcaacatcggagacgatccacaccatccacctgga
aagactccacctcggagggtggatcctccactcacatcacccaataagacgaagacagaa
aaggtgggcgtggtcattgctaatgccacaaaagtcgagcccgccctcttgaaagccagt
aatgacagttcaaatattgttcaaaaagcttctttgaaccaagcaggatga

KEGG   Danio rerio (zebrafish): 768123Help
Entry
768123            CDS       T01004                                 

Gene name
b4galt1l
Definition
(RefSeq) beta-1,4-galactosyltransferase 1
  KO
K07966  beta-1,4-galactosyltransferase 1 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00052  Galactose metabolism
dre00510  N-Glycan biosynthesis
dre00513  Various types of N-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre00515  Mannose type O-glycan biosynthesis
dre00533  Glycosaminoglycan biosynthesis - keratan sulfate
dre00601  Glycosphingolipid biosynthesis - lacto and neolacto series
dre01100  Metabolic pathways
Module
dre_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
dre_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    768123 (b4galt1l)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    768123 (b4galt1l)
   00513 Various types of N-glycan biosynthesis
    768123 (b4galt1l)
   00515 Mannose type O-glycan biosynthesis
    768123 (b4galt1l)
   00514 Other types of O-glycan biosynthesis
    768123 (b4galt1l)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    768123 (b4galt1l)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    768123 (b4galt1l)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    768123 (b4galt1l)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    768123 (b4galt1l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    768123 (b4galt1l)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     768123 (b4galt1l)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     768123 (b4galt1l)
    2.4.1.90  N-acetyllactosamine synthase
     768123 (b4galt1l)
    2.4.1.-  
     768123 (b4galt1l)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   768123 (b4galt1l)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    768123 (b4galt1l)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   768123 (b4galt1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 768123
NCBI-ProteinID: NP_001070727
ZFIN: ZDB-GENE-061013-84
Ensembl: ENSDARG00000104404
Vega: OTTDARG00000028190
UniProt: C1KH59
LinkDB All DBs
Position
14
AA seq 350 aa AA seqDB search
MPDSTGNFSLLQRTCSLVVLLCFLHIFVTVIYYMRNSDSRPAFAQNQQQRPTIHRKLAEQ
RGTTEDSRPAANASSNGQELQICPEEPPRLVGPLRVEFSDPITLEMVRTENSVLQEGGRF
RPPDCIARQKVAMIIPFRNRDEHLKFWLYYLHPILQRQQLDYGVYVINQDGEDTFNRAKL
LNIGYAEALKEYDYDCFVFSDVDLIPMDDRNIYKCYNQPRHLAVSMDKFGFRLPYTQYFG
GVSSLSKEQFLKINGFPNNYWGWGGEDDDIFNRISSRGMSISRPDGLLGRCRMIRHERDK
QNDPNPQRFDRIAHTRETMATDGINSLKYNVVKIEKDLLFTKITVDVGKP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccggactccaccgggaacttcagcctcctgcagcggacctgctctctggtggtgctg
ctgtgcttcttacacatctttgtcaccgtcatttactacatgaggaactcggactctcgg
ccagctttcgcccagaaccagcagcagagaccgacgatacacaggaaactggcggagcag
aggggcaccactgaggacagcagacccgcggccaacgcctcgagcaacggccaggagctg
cagatctgcccagaggagccgccgcgcctggtgggtcctctgcgtgtggagttctcagac
ccgatcacgttagaaatggtgcggacagagaacagtgttctgcaagagggcggacgcttc
agacccccggactgcatagctcggcagaaggtggccatgatcatccccttccggaaccga
gacgagcacctgaagttctggctctattacctgcaccccatcctgcagcgccaacagctc
gactacggcgtctacgtcattaaccaggatggcgaggacacgtttaatcgagctaaactc
ctgaacatcggctatgcggaggcgctgaaggagtacgattacgactgttttgtgttcagc
gacgtggacctgatcccgatggatgaccgcaacatctacaagtgctacaatcagcccaga
cacctggccgtctccatggacaagttcggcttcaggctgccgtacacacagtatttcggt
ggcgtttcgtcgctcagcaaagagcagttcctgaagatcaacggattccccaacaactac
tggggctggggcggagaggacgacgacatcttcaacaggatctcctccagaggaatgtcg
atatctaggcctgacggactcctgggtcgctgtaggatgatccgtcatgagagagacaag
cagaacgacccaaaccctcaaagatttgaccgaatcgcgcacacaagggaaaccatggca
actgacgggatcaattcgctaaaatataacgtggtaaaaatcgagaaagacctgctcttc
accaaaatcacagtggacgtgggcaaaccctga

DBGET integrated database retrieval system