KEGG   Danio rerio (zebrafish): 100148922Help
Entry
100148922         CDS       T01004                                 

Gene name
si
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00052  Galactose metabolism
dre00500  Starch and sucrose metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100148922 (si)
   00500 Starch and sucrose metabolism
    100148922 (si)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100148922 (si)
    3.2.1.20  alpha-glucosidase
     100148922 (si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100148922
NCBI-ProteinID: XP_017207468
ZFIN: ZDB-GENE-030131-4622
LinkDB All DBs
Position
18
AA seq 1809 aa AA seqDB search
MGKRRFSGLEVTLMVLFALALVVAVALIVVLATGEPGTIREDSGSDPDIVPECPDIPLTD
RVDCFPDGGASQQKCLERACCWSPLDETNVPWCFFSKNHGYTADRVSNPDSTHIEAKLTR
MNAPSLFGADIKDLTFHGEMQTENRFRFKITDAKQARFEVPHENVKAPANPPTGPLKYKV
EIVQKPFGVKIWRTTPEKLLFDTTIGPLVFADQYLQLSAKLPSHNIYGLGEHVHQTFRHD
TNWRTWPIFTRDSFPNGGTHNLYGHYPYFTCLEDESGQSIGVFLMNSNAMEVTIQPAPAV
TFRTIGGVLDFYVLVGDTPEAVVDEFTKLIGRPFIPPYWSLGFQISRWDYGSLDAVKEVV
ERNRNASLPYDVQYTDIDYMEEKKIFTYDLVKFADLPNFADYMHDKGQKYIVILDPAVST
GRRLNGPYDTVDRGHAAKVWVTESDGETPLVGEVWPGETVFPDFTNEACIKWWVDEISRF
HKEVKHDALWIDMNEISNFIKGSNKGCADNKLNYPPFTPRILDDLMYSKTLCMDAKQKWG
NHYDVHSLYGYSMVLATERASKEVFGTNRSMVFTRSSFPGVGKYSGHWLGDNGANWNDIK
WAIPGMLEFNLFGIPYIGADICGFFDNSTEELCRRWMQVGAFYPFSRNHNAQGYEDQDPA
SYGLDSLLVNTSRHYLNIRYKLLPYLYTLFYKAHVNGETVVRPLMHEFYSDSQTWDIHKQ
FMWGAHLLITPVLDPGVHYVEAYIPDAIWYDFENEIKITERKEGVKMYLPDDKLGLHLRG
GAILPVQRPDVTTTYSRRHPMGLIIALDDNKSASGELFWDDGDSRDTVSSGNHIHYQFSV
TDGSLTMHVTKNGYSDPNNLKFENITILGFSSAPPFVLVSDGTTSNPLPQSQIQYDSVKQ
VLNLRNLELELGKSYTISWEAKAERIDCYPEEGATKAECEGRGCIWEPLAVPMCYYSENH
GYKASNVVENMYGITADLEINTAFPSQRSQSPDINKLRVEITFHDEICLRWKIYDPEKAR
YEVPVPLNLPNPPPLWGEQTYKVEINEEPFGIRVIRKDTSEVIFDSVLPGFIFSDQFIQI
STRLPTEYVYGFGETEHPSYKHDLNFHTYGLFAKDQPPGYKLNSYGIHPFYMGMEKSKKA
HGILLLNSNAMDVSFQPIPALTYRTTGGILDFYMVLGPTPEEVVQQYTELIGRPVLPAYW
SLGFQLCRYGYANDSEIADLYRDMRAAEIPYDVQYADIDYMERQMDFTLDKTNFLGLPAL
VDRMRGEGMRFIFILDPAIAANETTGSYAAFDSGIEKDVFIKWPPALSNDIVWGKVWPDY
PNITVDNSLDWDTQVELFRSFVAFPDFFKNGTAEWWADQIKDYYDNVMKFDGLWIDMNEP
ASFVHGTVGGKCLGDPLLENPPYMPPLESKEKGLNHKTLCMNSEQILADGTRVRHYDVHN
LYGLSHTKPTYDALHSTTGKRGVIITRSTYPTSGRWAGHWLGDNYSAWDQLLKSIIGMME
FSIFGVSYTGADICGFFNPAQKEMCLRWMQLGAFYPFSRNHNTINMPRQDPVAWGPEFAN
MSRDVLNIRYTLLPYLYTLMYEAHTKGTTVVRPMLHEFVNDEKTWDIDRQFLWGSALLIT
PALEEGVTVVKGYLPKTRWYDYHTNEVVEGQGQFVDMDTPLDKINLHVRGRYIIPYQNPE
RNTQLSRKNPMNLLVALDGSGYATGNLFWDDGEGIDTLKNRKYIYKQFSASRGSLSGVRE
TGLEEADRPLLGEVKVLGVSSSVTEVTITVTGGSTTPLTFDYYPETQVLIIHVTPQKFKI
DEYFNIVWK
NT seq 5430 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcggcggttctcagggttggaggtgaccctgatggtgctgtttgctttggcg
ctggtggtcgctgtcgcattaatcgttgtactggccactggggaaccagggacgatcaga
gaagattcaggatccgatccagacatcgtcccagaatgtcctgacattcctctaacagac
agagtggactgttttcccgacggcggtgcatctcagcaaaaatgtttggaaagagcctgt
tgctggagccccctggatgagaccaacgtcccctggtgcttcttttccaaaaatcacggc
tacaccgcggaccgcgtaagcaatcctgacagcacacatatcgaggccaagctgacaaga
atgaatgctccttctctgtttggagctgatattaaggatttgaccttccacggtgaaatg
cagacagaaaaccgctttcgatttaagatcactgatgcaaagcaagccaggtttgaagtt
cctcatgaaaacgtgaaagcccctgccaaccctcccaccggacccttaaaatacaaagta
gagatcgtccagaagccctttggagtgaaaatctggagaacaacaccagaaaaactcctg
tttgacaccaccattgggccactggtttttgctgatcagtaccttcagctctcagctaaa
ctcccctctcacaatatttatggcctcggagagcacgtccatcagaccttccgtcatgac
accaactggaggacctggcctatcttcacaagagactctttccccaacggcggcacacac
aacctgtatggccactacccctattttacgtgtctggaagatgagagcggtcaatccatt
ggcgttttcctcatgaacagcaatgctatggaggtgactatccagccagctcctgctgta
accttccggactattggaggggttttggacttttatgtcctggttggagacacaccggag
gcagtggtggacgagttcaccaagctgattggcaggcctttcatccctccatactggtct
ctgggcttccagatctctcgctgggactacggcagcctggatgcggtcaaagaagtggtg
gagagaaaccgaaatgccagcctgccatacgacgtccagtacactgacattgactacatg
gaggaaaaaaagatctttacctatgatttggtgaaatttgcggatctgcccaactttgct
gactacatgcatgataaaggacagaaatacattgtcatactggatcctgccgtatccaca
gggcgcaggttaaacggaccgtatgacacagtcgacaggggacatgcagctaaagtttgg
gtcactgaatcagatggtgaaacgcctctagtgggagaggtctggccaggagaaaccgtg
ttccctgacttcactaatgaggcttgcattaagtggtgggttgatgagatttcacgtttc
cacaaagaagtcaagcacgatgctctttggattgacatgaacgagatctccaactttata
aagggaagtaacaaaggctgcgctgacaacaaactcaactatccaccgttcaccccacgt
atccttgatgacctgatgtacagtaagaccttgtgtatggatgctaaacagaaatggggg
aaccactatgatgtccacagtctttatggctactcaatggttctggccactgagagggca
tcgaaagaagtgtttgggaccaaccgatccatggtcttcacccgctcttcattccccggt
gtgggcaaatattctgggcattggttgggagacaacggcgccaactggaatgacattaag
tgggcgatacctggcatgctggagtttaacctctttggcatcccttacattggtgcagat
atctgtggtttcttcgataactcgacggaggagctttgcagacgttggatgcaagttggt
gcattttaccccttcagccgaaaccacaacgcacaaggatacgaagaccaggatcctgcg
tcgtacggcctggactctctgctggtgaacacctccaggcattacctgaacatccgctac
aagctgctgccatacctgtacacactgttctacaaggcccatgttaacggagagactgta
gtgcgtcccctgatgcatgagttctattctgacagtcaaacatgggatatacacaagcag
ttcatgtggggagcacatctcctcatcacacctgtactggatcctggtgttcattatgtg
gaggcctatattccagacgccatctggtatgactttgaaaacgaaataaagattacagaa
cggaaagagggagttaaaatgtacctgcctgatgataaacttggtttacatctgagagga
ggagccattctacctgtacaaagaccagacgtcacaaccacatacagtcggcgtcatccc
atggggctgatcatcgctctggatgacaacaagtctgcgtcaggagagctattttgggat
gacggagactctcgagatactgtttcatctggaaatcacattcattaccagttttcagtg
actgatggctccttgacaatgcatgtcacaaagaatggatactcagatccaaacaacctg
aagtttgagaacatcacaattttgggattcagctctgctccaccttttgtgctggtgtca
gacgggaccactagtaaccctttgcctcagtcacagattcaatacgactctgtcaagcag
gtgctgaatttgaggaatctggagctggaactcgggaagtcatacactatcagctgggag
gccaaagccgaaagaatcgactgctacccggaggagggtgccactaaggctgaatgtgaa
ggacgtggatgcatatgggagcctttagctgttcccatgtgttattactcagagaaccat
ggctacaaagccagcaacgtggttgaaaatatgtatggcatcactgcagatttagagatc
aatacagctttcccaagtcagcgttctcagtctccagacatcaacaagcttcgcgtggaa
atcacattccatgatgaaatctgcctacggtggaagatctacgatccagaaaaggcccgc
tatgaggtccctgttcccctcaacctgccaaacccacctccgttatggggtgagcaaacc
tataaggtggaaatcaacgaagagccatttgggatccgagtgataagaaaagacacatca
gaagttatatttgattcggttctgccaggcttcatcttctcagatcagttcatccagatc
tccacacgtctccccaccgaatatgtctatggttttggtgagacagagcatcccagctat
aaacatgacctcaactttcacacatatggactgtttgccaaagaccagcctccagggtac
aagctgaacagttacggaatccatcctttctacatgggcatggagaaaagtaaaaaggct
catggcatcctcctgctcaacagcaatgccatggatgtgtccttccagcctattccagcc
ctaacctaccgcaccaccggaggcatcctggacttctacatggtcttgggacccacacca
gaagaagtggttcagcagtacactgagttgattggccgtccggttcttccagcctattgg
tcgcttggattccagctttgtcgctatggctacgccaacgattcggagatcgcagatctt
tacagagacatgagagctgctgagatcccctatgacgttcagtatgcagatattgactat
atggagaggcagatggacttcactctggacaaaactaatttcctgggactgcctgctctg
gtggaccgcatgaggggagagggcatgcgtttcattttcattctggacccggctatagca
gccaatgagacgacagggtcctacgctgcatttgacagcgggattgaaaaagacgttttc
atcaaatggcctcctgcgctcagcaatgacattgtgtggggaaaggtttggcctgactat
cccaatatcaccgtggacaattctttggactgggatactcaagtagagctcttcaggtct
ttcgtggcgttcccagatttcttcaagaacggtacagctgagtggtgggcggatcagatt
aaagactattacgacaacgtcatgaagtttgacgggctttggattgacatgaatgagcca
gccagtttcgtgcacggcactgttggaggaaaatgtctaggggatccccttctggaaaat
cctccatacatgccaccactggagtccaaggaaaaaggtctgaaccataagactttatgc
atgaacagcgagcagatccttgctgatggcacgcgcgtcagacattatgacgttcacaac
ttgtacggcttatctcacaccaaacccacctacgatgctttgcatagtaccaccggaaag
agaggagttataattacccgctcaacatacccaacgagtggacgctgggctggacattgg
ctgggagacaactactctgcctgggaccagctcctcaagtccatcataggcatgatggag
ttcagcatattcggcgtctcttacactggtgccgatatctgtggcttctttaaccctgcc
caaaaggagatgtgtctgcgctggatgcagctcggagctttctatcccttctccagaaac
cacaacaccataaacatgccaagacaagacccagtggcctggggaccagagtttgccaat
atgtctcgtgatgtgctgaatatccgctacaccctcctgccatacttgtacaccctgatg
tatgaagcccacaccaaggggaccactgtggtcagaccaatgctgcacgagtttgtcaat
gatgaaaagacatgggacattgataggcagttcctctggggttctgctcttctgatcaca
cctgctttggaagagggcgtcactgtggtcaagggatacctgccaaaaacccgctggtac
gattaccacacgaatgaagttgtggaagggcaaggacagtttgtggatatggacacacct
ttagacaaaattaacctgcatgtgagaggacgatacatcattccctatcagaatccagag
agaaacacacaactaagtcgtaagaatcctatgaacctgcttgttgctctggatggatca
ggttatgcaactggtaacctgttttgggatgacggagaaggaattgatacccttaagaat
agaaaatacatctataaacaattctctgcatcgaggggttccctttcgggtgtccgtgaa
actgggctggaggaggccgacagacctttactgggcgaagtgaaggtgttgggcgtatca
tcatccgtcacggaggtcaccattactgtaactgggggcagtacaacacctttgactttc
gattattaccctgagactcaggtgttgattattcatgtaacaccgcagaaattcaaaatt
gatgagtatttcaacattgtctggaaatag

DBGET integrated database retrieval system