KEGG   Danio rerio (zebrafish): 100149258
Entry
100149258         CDS       T01004                                 

Definition
(RefSeq) uncharacterized protein LOC100149258 precursor
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100149258
   04012 ErbB signaling pathway
    100149258
   04020 Calcium signaling pathway
    100149258
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100149258
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100149258
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100149258
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 100149258
NCBI-ProteinID: NP_001122291
UniProt: B3DH46
LinkDB
Position
23
AA seq 1429 aa
MGQQVLALCALLFLCVPQPVTSQTQEVCTGTKNALSSTGTPEQHYNNLKERYTGCEIVMG
NLEITQMENDLDFSFLGSIREVTGYILIAMNQFRKLPLNQLRVIRGSSLYDKEWALSVFH
NFDTHTGLEDLGLTNLTEILEGGVQIVHNRNLSYAPLINWQDIVRDGDARIQIQDNGGRG
SCNPACGEFCWGPSNDQCQKLTKTVCALQCLGHCFGTNPNECCHPECAGGCTGPRDTDCF
ACRHVNYSGSCVPHCPWPVVYNQQTFQVEPNADAMYQFGSICVPKCPGHFVVDGSACVSS
CPPGKTEIEKNQIKQCETCIGLCPKVCEGTGANHRQTVDSSNIDSFINCTKIQGSLHFLI
LGIKGDVYNNIPPLEPEKLKVFNTVREITGILNIQSWPDELHDLSVFSSLTTIQGRSLYN
PKRPFSLLVMKIPSLTSLGLRSLREISDGSVYITQNMNLCYHHTINWTQIFPRNQLQRRR
NDIKENKQKIQCEEEGHVCDPLCSDAGCWGPGPEQCLSCRNYSRLGTCVSHCNLYYGEPR
EFAASNKECLACHSECLLQNGKQTCLGKGADQCVACSNLMDGPHCVSSCPNGVNGEKGQT
IFKYSTAVGHCELCHFNCTRGCTGPALRDCVDPDRNVNSSQIAGIAVAVFAGITVLLALF
VLGMLYHRGLAIRRKRALRRYLESGESMEPLDPGEKGTKVHARILKPQELRKGKLLGYGV
FGTVNKGLWIPEGDSLKIPVAIKTIQNRSGRQTFTEITDHMLSMGSLDHPYIVRLIGICP
GASLQLITQLSPHGSLLQHLRQHKDSLDPQRLLNWCVQIAKGMYYLEEHCMAHRNLAARN
ILLKSDYIVQISDFGVADLLYPDDKKYVYSEHKTSIKWMALESILFGRYTHQSDVWSYGV
TVWEMMSYGAEPYASMHPHDVPGLLEKGERLAQPQICTIDVYMVMVKCWMIDENVRPTFK
ELASEFTRMARDPPRYLVVRPAQNGGGAEESQRYVKSSHLEVGLEEEDDDEDEGLQVGFA
TPPLQLSPTRSHSRVRIASYKSTSEHTAPIGYLPMTPGPGDEPRQLRAQRRKTGSVRTES
ECSEGRGTIVDIEAVEITSQTGSLRRGRSRMDSAYISGGVSVASDPFSPGLEGVDEDHYG
YVLPTERDFRSAVPHGRTSRHSKSTPKTDATQEYELMNKQTNKLSSSPTDSTDHLKPASL
VSAHICSSLPQKKEMDSAQTQDEILPQKRETDSTQSQENNLPQKSETDSTQTQESEKDAS
FQPDNFESAENCLIGSETLNDGGQSEEEEQQPRLVMVEYEYMDIRTDEHQQNVAGKRTTN
GPNEVEREAIYQNISQPLRFHENPDSAGNTMQRRGEYVDMEASGRSGCEVGDYQNVPVKG
RPVVGEESQNTGLRSYIKVCAGVEPQNTSFDNPDYWHSRLFHKQDTVCT
NT seq 4290 nt   +upstreamnt  +downstreamnt
atgggacagcaggtgctcgcgctctgcgctctcctgttcctctgtgtacctcagcctgtc
acttcacaaacacaagaagtttgtactggcactaaaaatgctctgagctccacgggcacc
ccagaacagcactacaacaaccttaaagagcgctacaccggatgtgagatcgtcatgggc
aatcttgagattacacagatggagaatgacctcgatttctcctttcttggaagtatccga
gaggtcaccggctacatcctcattgcgatgaaccagtttcgcaagttacctttgaatcag
ctcagagtgattcgtggcagcagcttgtatgacaaagaatgggctctttctgtctttcat
aactttgacactcacactggcctggaagatctgggcctcaccaacctcacagagatcttg
gaaggtggagtacagattgtccacaacaggaacctcagctatgctccattgatcaactgg
caggacattgtcagagacggtgacgctcgcatccagatccaggacaatggaggaagaggg
tcctgcaatcctgcatgtggagagttttgctggggtccaagtaatgatcagtgtcagaaa
ttgactaaaacagtatgtgcacttcagtgtctgggccactgtttcggcaccaaccctaat
gaatgctgccaccccgagtgtgctggaggctgcactggacccagggacacagactgcttt
gcctgtcgacatgtcaattactctggctcctgcgtccctcactgcccttggcctgtggtc
tacaaccaacagacctttcaggtggagcccaatgctgatgccatgtatcagttcggttcc
atctgtgttcctaaatgtcccgggcactttgttgtggatggcagtgcatgcgtgagcagt
tgtcctcccggtaaaacagaaatagagaagaatcaaattaaacagtgtgagacctgcatt
ggcctgtgtcccaaagtatgtgagggaactggagccaatcacagacagacagtggactcc
agtaacattgacagctttatcaattgtaccaagatccaaggaagtctacattttctgatc
ttaggtatcaaaggagacgtctataataacataccacctctggagcctgaaaaactcaaa
gtgtttaacacagtcagagaaattactggtattttgaacattcagtcttggcccgatgaa
ctccatgatctatctgttttctctagtctcactaccattcagggaagatctctgtacaat
cctaagaggccattctctttgttggtgatgaagattccctccctcacatctctaggactg
cgctccttgcgggagatcagcgacggcagtgtatacatcactcaaaatatgaacctgtgt
tatcaccacaccatcaactggacacagatcttcccacgtaaccaattgcaacgcagacgt
aacgacatcaaggaaaacaaacaaaagatccagtgtgaggaagagggccatgtgtgcgac
ccgttgtgttcagacgcaggatgttggggcccggggcctgagcagtgtttgtcatgcagg
aactacagtcggctcggcacctgtgtgtctcactgtaacctctactacggagagccgcgg
gagtttgcagcatctaataaggagtgtcttgcttgtcactcagagtgtctgttgcagaat
gggaaacaaacatgcctaggaaaaggtgcagatcagtgtgtagcgtgttcaaacctgatg
gacggccctcactgtgtttcttcttgtcctaatggagtgaatggagaaaaggggcagacc
atatttaaatactccactgcagtgggtcattgtgagctctgtcacttcaactgcacacga
ggatgtacaggccctgcgttgagagactgtgttgatcctgacagaaatgtgaacagctct
cagattgcagggatagcagttgccgtgtttgctggtattactgtacttctggcgctgttt
gtgcttggtatgctgtatcacagaggcctggccattcgacgcaaaagagcactgagaaga
tatctagagagtggtgagagcatggagccgctggatccaggagagaaggggacaaaagtg
catgcccgcatcctaaaaccacaggagctgcgaaagggcaaacttctgggttacggagtc
tttggcaccgttaataagggtttgtggattcctgaaggtgactccctaaaaatccctgtg
gccataaagaccatccagaaccgcagcggtcggcagaccttcacagagatcactgatcat
atgctttcaatgggaagcctggatcacccgtatatagtgcgtctcattgggatctgccct
ggggccagtttgcagttgatcacgcagctcagtcctcatggatcgttacttcaacacctt
cgccagcacaaagacagcctggaccctcagcggctgctcaactggtgtgtgcagatcgct
aagggcatgtattatctggaggagcactgcatggcccataggaacctggctgcacgaaac
atactgctcaagagtgactacatagtacagatctcggactttggggttgcagatctgctc
tatccagatgataagaaatatgtgtacagtgaacacaagacatcaataaaatggatggca
ttagagagcatcctcttcggcagatacactcatcagagtgacgtgtggagctacggtgtg
acggtatgggagatgatgtcatacggagcggagccatacgcttctatgcatcctcatgat
gtgccgggtctgctggagaaaggagagcgtctggctcaacctcagatctgcaccatagac
gtctacatggtcatggtcaagtgctggatgattgatgagaatgtgagacccacatttaaa
gaactagccagtgaatttacaagaatggcaagggacccgccacgctaccttgtggtgagg
cctgctcagaatggcggcggtgcagaggaaagccagcggtatgttaaaagctctcatcta
gaggtaggattggaagaggaggacgatgatgaagatgaaggattgcaggttgggtttgcg
actcctcctctccagctctcacctactagaagtcattcccgtgtccggattgcctcctac
aagagcacctcagaacacacagcaccgataggttatctccccatgaccccaggcccagga
gatgagcctagacagttgcgagcccagaggaggaagactggctcagtgaggacagagtct
gagtgttcggagggccgggggaccattgtggacattgaagcagttgaaatcacttctcaa
acaggcagtcttcgcagaggacgcagtcgaatggacagtgcctacatatctggcggagtg
tctgtcgcatcagatccattctctcccggtctggaaggagtagatgaagaccattatgga
tacgtgctgcctaccgaaagagatttcagaagtgctgttcctcatggtaggacatccaga
cactccaaaagcactccaaaaacagatgccacgcaagagtacgagctaatgaacaaacag
acaaacaaactttcctcctcgcccacagacagcactgaccatttaaaaccagcatccctt
gtttctgcacacatatgtagcagtttacctcagaaaaaagaaatggactcagcacaaacc
caagatgaaattttaccacagaaaagagaaacagactcaacacaaagccaagagaacaat
ttaccacagaaaagtgaaacggactcaactcaaacccaagagtcagagaaggatgctagt
tttcaacctgacaactttgagtctgctgaaaactgtctgattggatcggaaacattaaac
gatggtggtcaatctgaagaggaagaacagcagccacgattggtgatggtcgaatatgaa
tacatggacatacgtacagatgaacaccaacaaaatgtagctggcaaacgtacaacaaac
ggtccaaatgaggtggagagggaagcgatttatcaaaatataagtcaacctctaagattt
catgaaaatccagattctgctggcaatacgatgcagaggcgcggtgaatatgtggacatg
gaggcatctgggagaagtggctgtgaggttggagattatcagaatgtcccggtaaaggga
aggcctgttgtgggagaggagtcgcaaaatactggcctcagatcttacataaaagtgtgt
gctggagtggagccgcaaaacacttcttttgacaacccagattactggcacagcagactt
ttccacaagcaggacaccgtgtgcacatga

KEGG   Danio rerio (zebrafish): 386635
Entry
386635            CDS       T01004                                 

Gene name
erbb3a
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3a precursor
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    386635 (erbb3a)
   04012 ErbB signaling pathway
    386635 (erbb3a)
   04020 Calcium signaling pathway
    386635 (erbb3a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    386635 (erbb3a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     386635 (erbb3a)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   386635 (erbb3a)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like GF_recep_IV Kinase-like
Other DBs
NCBI-GeneID: 386635
NCBI-ProteinID: NP_001005320
ZFIN: ZDB-GENE-030916-3
Ensembl: ENSDARG00000006202
Vega: OTTDARG00000033795
UniProt: Q8AW81
LinkDB
Position
6
AA seq 1305 aa
MYKCMCICVNNFTLSLSLSAVGVCTGTQNLLSVTGSSEVQYKLMKEMYTGCQIVIGNLEI
TQMEHNRDFSFLQSIREVTGYILIAINQFRRLPLEQLRVIRGTSLYEDKFALAVLVNYQK
DGVYGLRELGLTHLTEILEGGVQIIQNKFLSYAPQINWQDIVKNSGAEVIIQDNGPEVPC
HESCGGPCWGPGNDTCQILTKTVCALQCNVRCFGRSPSECCHNECAGGCTGPLDTDCFAC
RNFNNSGSCVSQCPRADIYNKVTFKMEPNPNAKYQFGSMCVSHCPPNFVVDGSSCVSSCP
ADKMEVDKTGVKRCEKCEGLCPKACVGTGTGTASRQTVDSQNIDSFINCTKIQGSLHFLV
TGIKGDSYNNISALDPRKLKIFNTVREITDILSIQSWPEELEDLSVFSNLATIQGRTLYR
GYSLLVMKIPTLKSLGLRSLKRISDGGIYITGNTQLCYHHTVNWTRLFGSGPRALRRQKS
LDIKENRPQEQCRLLGSGTRSVFVLQELQKRRNMCTRLQLHVRGSDECKACAHLQDGPYC
VSSCPEGVQGENGLIIYKFPNRQNKCQPCHANCTLGSTHYGVNIVRYRLPVTAIVLSVIF
CVLLAFSVFVLSVLYRRSLSIRRKRAMRRYLQSGESFEPLEPGEKGVKVHARILRTSELK
KIKLLGSGVFGTVHKGIWIPEGDTVKIPVAIKTIQDRTGRQTFQEITDHMLAMGSLDHAY
IVRILGICPGASLQLVTQLSPQGSLLEHIRQRRDNLNPQRLLNWCVQIAKGMYYLEEQRM
VHRNLAARNILLKSDLIVQIADYGIADLLYPDDKKYFFNEIKTPIKWMALESILFRRYTH
QSDVWSYGVTVWEMMSYGAEPYSAMRPQEVPDLLEKGERLSQPQICTIDVYMVMVKCWMI
DENVRPTFKELANEFTRMARDPHRYLVIKEEDRAPDSASDETHQNGTEIDILGVALEDQD
DEVLEDAIDAPRYITPSRSFSRLRIDSHRSSLTPSTTAGYLPMTPGLESSVQTGWASRSR
LDSACTVSESSEGRGALELEMNDDFSSVGSLRRVRHREDSAYMSQRDSLSGPPETTSTGT
QGEEDQNEYVLPGFGESPEKETLLFTSSRSTLSQKRLSRGHSGDFLEANRGAGEEYEYMN
NQTLSLSHIPGQLKEYNQRAPRNRSASFNPGGMYSNHKPSRPSKRSSIEGSESSGGLSQS
STDQRSHSDGDFLSSEAEYTDGDLEGGGGEAYEYEDMDSLAAGGASGAEYQNLDGEDEER
DEDWSGGPRSPGPYVQVHAGTNHNAFDNPDYWHSRSFHKTKAVHT
NT seq 3918 nt   +upstreamnt  +downstreamnt
atgtataaatgcatgtgtatttgtgttaataacttcactttgtctctgtctctctctgca
gttggagtgtgtacaggcactcagaatttgctgagtgtgacgggaagctctgaggtccaa
tacaaactcatgaaggaaatgtacacaggttgccagattgtcataggaaacctggagatc
acacagatggagcacaaccgcgatttctcattcctacagtctatccgtgaggtaaccggc
tacatcctcatcgctataaaccagttcagacgtttaccgctggagcagctgcgggttatc
cggggaacgtctctgtatgaagataaattcgccctcgctgtccttgtcaactatcagaaa
gacggagtgtatggactgagggagctgggcctcacacacttgacagagatcctggagggt
ggcgtgcagatcatccagaataaattcttgagctacgcaccgcagattaactggcaagac
attgtgaaaaacagtggagcagaagtcatcatacaagacaatggaccagaagttccctgt
catgagtcttgcgggggtccatgttggggtccaggaaatgacacctgtcaaatcttgact
aagacagtgtgcgcactgcaatgtaacgtgcgctgttttggacgcagcccgagtgagtgt
tgccataatgagtgtgccggcggctgcaccggacccctcgacaccgactgctttgcctgc
agaaacttcaacaactcgggctcgtgtgtgtcgcagtgtccaagggctgatatttacaac
aaagtaactttcaaaatggagcccaatcctaacgccaaataccagtttggctccatgtgt
gtgtcacattgccctcctaattttgttgtagatggcagttcgtgtgttagcagctgtcca
gcagacaagatggaggtggataaaacaggggtgaaaaggtgtgagaagtgtgaaggcctc
tgtcctaaagcctgtgttggcaccggcaccggcaccgcctccagacagacagtagattcc
caaaacatcgacagcttcataaactgcaccaagattcagggcagcctgcacttccttgtc
acaggaattaaaggagacagttataataacatcagtgctctggatccaaggaaacttaag
atcttcaacactgtccgagagatcacagacattctgagtattcaatcttggcctgaagag
ctggaagatctttctgttttctccaatctagcaacaatacagggaagaacactgtatagg
ggttattctcttttggtgatgaagatcccaacgctgaagtctctgggccttcgctctctg
aagcgaatcagtgatggagggatctacatcacaggaaacacacagctctgttatcatcac
actgtgaactggacgcgtttgttcggcagcggtccgcgagccctgcgccgccaaaaatca
ctggacatcaaggagaatcgccctcaggagcaatgcaggctgctggggtccgggacccga
tcagtgtttgtcctgcaagaacttcagaagaggaggaacatgtgtaccagactgcaactt
catgtccggggctctgatgagtgcaaagcgtgtgctcatctgcaggacggcccgtactgt
gtgtcctcctgtccagagggagttcagggggaaaacggactcatcatttataagttccct
aatagacaaaacaaatgccaaccttgtcatgccaactgcaccttgggctcaactcattat
ggtgtgaatattgtgcgttacaggctgccggtcaccgccatcgtgctgagcgtcatattc
tgtgtcctgctcgcgttttcggtgtttgtgctgagtgtgctttaccgcaggagtctctcc
atccgcagaaaacgagccatgaggagatacctgcagagcggagagagctttgaaccgctg
gaacccggagagaaaggtgtgaaagttcatgctcggattctgagaacttctgaattgaag
aagatcaagcttctgggctctggagtgttcgggacggttcacaagggcatctggatacca
gagggagacacggtgaagattcccgtggccatcaagactattcaggaccgcacagggcga
cagacctttcaggaaattactgatcacatgttggcaatgggtagtctggatcacgcgtat
attgtccgcatcctgggcatctgtccgggtgccagtctgcagctggtcactcagctcagt
ccacagggctctttactggagcacatccgccagcgcagggacaacctgaacccgcagagg
ctgctgaactggtgtgtgcagatcgccaagggcatgtactatctggaggagcagaggatg
gtgcacagaaacctggctgcccgaaatattctactcaagagtgatttaattgttcagata
gccgattatggcatcgctgacctgctctatcctgatgacaagaaatacttcttcaatgaa
attaagactcctataaagtggatggcccttgagagcatcttgttccgcagatacacacat
cagagtgatgtatggagctacggtgtgacggtctgggaaatgatgtcatacggggcagag
ccttactctgcgatgcgaccgcaggaagttcctgatctgttagagaaaggagaacgactc
tctcagcctcaaatctgcaccattgacgtctacatggtcatggtcaaatgctggatgatt
gatgaaaatgtacgtccaacttttaaagagctggccaatgaattcacccgaatggctcga
gacccgcaccggtacctggtcatcaaagaggaagacagagccccagactcagcctcagat
gagactcatcagaatggtactgaaatagacattctcggggtggcgctggaggaccaggat
gatgaagtcttggaggatgccatagatgctccacgctatataacaccatctagaagcttc
tctagactgcgtatagattctcatcggtcaagtttgactccatccactactgctggatat
ctacctatgactccgggtctggagagctctgtacagactggatgggcgtctcggtcccgt
ctggactcagcgtgcactgtttctgagagctcagagggacgaggagcgctggaactggaa
atgaatgacgacttctcatccgttggcagtctaaggagggtcagacatcgtgaagacagt
gcttacatgtcacagcgggacagtctttcaggaccaccagaaacaacctccacaggaact
caaggagaagaagaccagaatgaatacgtgctgcctggattcggtgaaagccctgagaaa
gaaactcttctgttcacatcatcacgttcaacgctttctcaaaagagactctcgagaggt
cattctggagactttctggaagccaacagaggtgctggtgaagaatacgagtacatgaac
aaccagacgctctctctcagccacataccaggacagctaaaagagtacaatcaacgagcg
ccacgaaaccgcagcgcctcctttaaccctggcgggatgtacagcaaccacaaacccagc
agacctagtaagaggtcatcgatcgagggctcggaaagcagcggaggactctctcaatcc
tcaactgaccagaggagtcacagcgatggagatttcctctccagtgaagcagaatacaca
gatggcgatctggagggcggtggaggagaagcgtatgaatatgaggatatggactcactg
gctgcaggcggagcttcgggagctgaatatcagaatctggatggagaagatgaggagagg
gatgaagattggtctggaggacctcgtagcccgggaccgtatgtacaggtgcacgctggg
accaatcataatgcttttgataaccctgattattggcacagcagatcatttcataaaact
aaagctgtccacacgtag

KEGG   Danio rerio (zebrafish): 544664
Entry
544664            CDS       T01004                                 

Gene name
erbb3b
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3b precursor
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    544664 (erbb3b)
   04012 ErbB signaling pathway
    544664 (erbb3b)
   04020 Calcium signaling pathway
    544664 (erbb3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    544664 (erbb3b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     544664 (erbb3b)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   544664 (erbb3b)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr GF_recep_IV Recep_L_domain Furin-like Pkinase Kinase-like
Other DBs
NCBI-GeneID: 544664
NCBI-ProteinID: NP_001014826
ZFIN: ZDB-GENE-050107-1
Ensembl: ENSDARG00000036993
Vega: OTTDARG00000021301
UniProt: Q5G254
LinkDB
Position
23
AA seq 1429 aa
MGQQVLALCALLFLCVPQPVTSQTQEVCTGTKNALSSTGTPEQHYNNLKERYTGCEIVMG
NLEITQMENDLDFSFLGSIREVTGYILIAMNQFRKLPLNQLRVIRGSSLYDKEWALSVFH
NFDTHTGLEDLGLTNLTEILEGGVQIVHNRNLSYAPLINWQDIVRDGDARIQIQDNGGRG
SCNPACGEFCWGPSNDQCQKLTKTVCALQCLGHCFGTNPNECCHPECAGGCTGPRDTDCF
ACRHVNYSGSCVPHCPWPVVYNQQTFQVEPNADAMYQFGSICVPKCPGHFVVDGSACVSS
CPPGKTEIEKNQIKQCETCIGLCPKVCEGTGANHRQTVDSSNIDSFINCTKIQGSLHFLI
LGIKGDVYNNIPPLEPEKLKVFNTVREITGILNIQSWPDELHDLSVFSSLTTIQGRSLYN
PNTPFSMLMMKIPSLTSLGLRSMREISDGSVYITQNMNLCYHHTINWTQIFPRNQLQRRR
NDIKENKQKIQCEEEGHVCDPLCSDAGCWGPGPEQCLSCRNYSRLGTCVSHCNLYSGEPR
EFAASNKECLACHSECLLQNGKQTCLGKGADQCVACSNLMDGPHCVSSCPNGVNGEKGQT
IFKYSTAAGHCELCHFNCTRGCTGPALRDCVDPDRNVNSSQIAGIAVAVFAGITVLLALF
VLGMLYHRGLAIRRKRALRRYLESGESMEPLDPGEKGTKVHARILKPQELRKGKLLGYGV
FGTVNKGFWIPEGDSLKIPVAIKTIQNRSSRQTFTEITDHMLSMGSLDHPYIVRLIGICP
GASLQLITQLSPHGSLLQHLRQHKDSLDPQRLLNWCVQIAKGMYYLEEHCMAHRNLAARN
ILLKSDYIVQISDFGVADLLYPDDKKYVYSEHKTSIKWMALESILFGRYTHQSDVWSYGV
TVWEMMSYGAEPYASMHPHDVPGLLEKGERLAQPQICTIDVYMVMVKCWMIDENVRPTFK
ELASEFTRMARDPPRYLVVRPAQNGGGAEESQRYVKSSHLEVGLEEEDDDEDEGLQVGFA
TPPLQLSPTRSHSRVRIASYKSTSEHTAPIGYLPMTPGPGDEPRQLRAQRRKTGSVRTES
ECSEGRGTIVDIEAVEITSQTGSLRRGRSRMDSAYISGGVSVASDPFSSGLEGVDEDHYG
YVLPTERDFRSAVPHGRTSRNSKSTPKTDATQEYELMNKQTNKLSSSPTDSTDHLKPASL
VSAHICSSLPQKKEMDSAQTQDEILPQKRETDSTQSQENNLPQKSETDSTQTQESEKDAS
FQPDNFESAENCLIGSETLNDGGQSEEEEQQPRLAMVEYEYMDIRTDEHQQNVAGKRTTN
GPNEVEREAIYQNISQPLRFHENPDSAGNTMQRRGEYVDMEASGRSGCEVGDYQNVPVKG
RPVVGEESQNTGLRSYIKVCAGVEPQNTSFDNPDYWHSRLFHKQDTVCT
NT seq 4290 nt   +upstreamnt  +downstreamnt
atgggacagcaggtgctcgcgctctgcgctctcctgttcctctgtgtacctcagcctgtc
acttcacaaacacaagaagtttgcactggcaccaaaaatgctctgagctccacgggcacc
ccagaacagcactacaacaaccttaaagagcgctacaccggatgtgagatcgtcatgggc
aatcttgagattacacagatggagaatgacctcgatttctcctttcttggaagtatccga
gaggtcaccggctacatcctcattgcgatgaaccagtttcgcaagttacctttgaatcag
ctccgagtgattcgtggcagcagcttgtatgacaaagaatgggctctttctgtctttcat
aactttgacactcacactggcctggaagatctgggcctcaccaacctcacagagatcttg
gaaggtggagtacagattgtccacaacaggaacctcagctatgctccattgatcaactgg
caggacattgtcagagacggtgacgctcgcatccagatccaggacaatggaggaagaggg
tcctgcaatcctgcatgtggagagttttgctggggtccaagtaatgatcagtgtcagaaa
ttgactaaaacagtatgtgcacttcagtgtctgggccactgtttcggcaccaaccctaat
gaatgctgccaccccgagtgtgctggaggctgcactggacccagggacacagactgcttt
gcctgtcgacatgtcaattactctggctcctgcgtccctcactgcccttggcctgtggtc
tacaaccaacagacctttcaggtggagcccaatgctgatgccatgtatcagttcggttcc
atctgtgttcctaaatgtcccgggcactttgttgtggatggcagtgcatgcgtgagcagt
tgtcctcccggtaaaacagaaatagagaagaatcaaattaaacagtgtgagacctgcatt
ggcctgtgtcccaaagtatgtgagggaactggagccaatcacagacagacagtggactcc
agtaacattgacagctttatcaattgtaccaagatccaaggaagtctacattttctgatc
ttaggtatcaaaggagacgtctataataacataccacctctggagcctgaaaaactcaaa
gtgtttaacacagtcagagaaattactggtattttgaacattcagtcttggcccgatgaa
ctccatgatctatctgttttctctagtctcactaccattcagggaagatctctgtacaat
cctaacacgccattctctatgttgatgatgaagattccctccctcacatctctaggactg
cgctccatgagggagatcagcgacggcagtgtatacatcactcaaaatatgaacctgtgt
tatcaccacaccatcaactggacacagatcttcccacgtaaccaattgcaacgcagacgt
aacgacatcaaggaaaacaaacaaaagatccagtgtgaggaagagggccatgtgtgcgac
ccgttgtgttcagacgcaggatgttggggcccggggcctgagcagtgtttgtcatgcagg
aactacagtcggctcggcacctgtgtgtctcactgtaacctctactccggagagccgcgg
gagtttgcagcatctaataaggagtgtcttgcttgtcactcagagtgtctgttgcagaat
gggaaacaaacatgcctaggaaaaggtgcagatcagtgtgtagcgtgttcaaacctgatg
gacggccctcactgtgtttcttcttgtcctaatggagtgaatggagaaaaggggcagacc
atatttaaatactccactgcagcgggtcattgtgagctctgtcacttcaactgcacacga
ggatgtacaggccctgcgttgagagactgtgttgatcctgacagaaatgtgaacagctct
cagattgcaggtatagcagttgccgtgtttgctggtattactgtgcttctggcgctgttt
gtgcttggtatgctgtatcacagaggcttggccattcgccgcaaaagagcactgagaaga
tatctagagagtggtgagagcatggagccgctggatccaggagagaaggggacaaaagtg
catgcccgcatcctaaaaccacaggagctgcgaaagggcaaacttctgggctacggagtc
tttggcaccgtcaataagggtttttggattcctgaaggtgactccctaaaaatccctgtg
gccataaagaccatccagaaccgcagcagtcggcagaccttcacagagatcactgatcat
atgctttcaatgggaagcctggatcacccgtatatagtgcgtctcattgggatctgccct
ggggccagtttgcagttgatcacgcagctcagtcctcatggatcattacttcaacacctt
cgccagcacaaagacagcctggaccctcagcggctgctcaactggtgtgtgcagatcgct
aagggcatgtattatctggaggagcactgcatggcccataggaacctggctgcacgaaac
atactgctcaagagtgactacatagtacagatctcggactttggggttgcagatctgctc
tatccagatgataagaaatatgtgtacagtgaacacaagacatcaataaaatggatggca
ttagagagcatcctcttcggcagatacactcatcagagtgacgtgtggagctacggtgtg
acggtatgggagatgatgtcatacggagcggagccatacgcttctatgcatcctcatgat
gtgccgggtctgctggagaaaggagagcgtctggctcaacctcagatctgcaccatagac
gtctacatggtcatggtcaagtgctggatgattgatgaaaatgtgagacccacatttaaa
gaactagccagtgaatttacaagaatggcaagggacccgccacgctaccttgtggtgagg
cctgctcagaatggcggcggtgcagaggaaagccagcggtatgttaaaagctctcatcta
gaggtaggattggaagaggaggacgatgatgaagatgaagggttgcaggttgggtttgcg
actcctcctctccagctctcacctactagaagtcattcccgtgtccggattgcctcctac
aagagcacctcagaacacacagcaccgataggttatctccccatgaccccaggcccagga
gatgagcctagacagttgcgagcccagaggaggaagactggctcagtgaggacagagtct
gagtgttcggagggccgggggaccattgtggacattgaagcagttgaaatcacttctcaa
acaggcagtcttcgcagaggacgcagtcgaatggacagtgcttacatatctggcggagtg
tctgtcgcatcagatccattctcttctggtctggaaggagtagatgaagaccattatgga
tacgtgctgcctaccgaaagagatttcagaagtgctgttcctcatggtaggacatccaga
aactccaaaagcactccaaaaacagatgccacgcaagagtacgagctaatgaacaaacag
acaaacaaactttcctcctcgcccacagacagcactgaccatttaaaaccagcatccctt
gtttctgcacacatatgtagcagtttacctcagaaaaaagaaatggactcagcacaaacc
caagatgaaattttaccacagaaaagagaaacagactcaacacaaagccaagagaacaat
ttaccacagaaaagtgaaacggactcaactcaaacccaagagtcagagaaggatgctagt
tttcaacctgacaactttgagtctgctgaaaactgtctgattggatcggaaacattaaac
gatggtggtcaatctgaagaggaagaacagcagccacgattggcgatggtcgaatatgaa
tacatggacatacgtacagatgaacaccaacaaaatgtagctggcaaacgtacaacaaac
ggtccaaatgaggtggagagggaagcaatttatcaaaatataagtcaacctctaagattt
catgaaaatccagattctgctggcaatacgatgcagaggcgcggtgaatatgtggacatg
gaggcatctgggagaagtggctgtgaggttggagattatcagaatgtcccggtaaaggga
aggcctgttgtgggagaggagtcgcaaaatactggcctcagatcttacataaaagtgtgt
gctggagtggagccgcaaaacacttcttttgacaacccagattactggcacagcagactt
ttccacaagcaggacaccgtgtgcacatga

DBGET integrated database retrieval system