KEGG   Danio rerio (zebrafish): 100149273
Entry
100149273         CDS       T01004                                 

Gene name
mapk9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04141  Protein processing in endoplasmic reticulum
dre04210  Apoptosis
dre04217  Necroptosis
dre04310  Wnt signaling pathway
dre04510  Focal adhesion
dre04530  Tight junction
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100149273 (mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100149273 (mapk9)
   04012 ErbB signaling pathway
    100149273 (mapk9)
   04310 Wnt signaling pathway
    100149273 (mapk9)
   04068 FoxO signaling pathway
    100149273 (mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100149273 (mapk9)
   04137 Mitophagy - animal
    100149273 (mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    100149273 (mapk9)
   04217 Necroptosis
    100149273 (mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100149273 (mapk9)
   04530 Tight junction
    100149273 (mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100149273 (mapk9)
   04621 NOD-like receptor signaling pathway
    100149273 (mapk9)
   04622 RIG-I-like receptor signaling pathway
    100149273 (mapk9)
   04625 C-type lectin receptor signaling pathway
    100149273 (mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100149273 (mapk9)
   04920 Adipocytokine signaling pathway
    100149273 (mapk9)
   04912 GnRH signaling pathway
    100149273 (mapk9)
   04914 Progesterone-mediated oocyte maturation
    100149273 (mapk9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100149273 (mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100149273 (mapk9)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100149273 (mapk9)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100149273 (mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 100149273
NCBI-ProteinID: XP_001919688
ZFIN: ZDB-GENE-091117-28
Ensembl: ENSDARG00000077364
Vega: OTTDARG00000031656
UniProt: E9QE29
LinkDB
Position
21
AA seq 421 aa
MTEGEGQFYSVQVGDSTFTVLRRYQQLRAIGSGAQGIVCSALDTVLGVPVAVKKLSRPFQ
NQTHAKRAYRELVLLKCVNHKNIIHLLNVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEILG
TPSLEFMNRLMETVRNYVMNKPQFPGVSFNELFPDWAFPSETEHDKIKTSQARDLLSKML
VIDPECRISVQEALNHPYIHVWYDPAEADAPPPQISDKQLEEREHSIEQWKELIYKEVMD
WEERNKNGVLKEECLDGTVNSSATPSQSSSINDISSMSTEQTLASDTDSSCIDTLTGPLE
E
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgactgagggggaagggcagttctacagcgtgcaggtgggcgactccacctttaccgtc
ctcagacgctaccagcagctccgcgccatcggatccggtgcccagggtatcgtctgctcc
gctctggacacagtgcttggcgtcccagttgctgtgaagaaactgagccggccctttcag
aaccagacccatgcaaagagggcctacagagagctggttctgctcaagtgtgttaaccac
aagaacatcatccatttgcttaacgtcttcacaccccagaagtcgttggaggagttccag
gatttgtatttggtgatggagttgatggatgctagtctttgtcaggtgatccacatggat
ctggaccatgagaggatgtcttacctgctctaccagatcctgtgtggcatcagacatcta
cactctgctggcatcattcacagggatctgaagcccagtaatatagtggtgaagtccgac
tgcactttaaagatcttagactttggactggccagaaccgcctgcactaattttatgatg
acaccttatgtagtgaccagatactacagagcgccagaggtcatcctgggcatgaaatac
aaggagaatgtggatatctggtctgtaggctgcatcatgggcgaaatggttaaagggagc
gtcatattccagggcactgatcatattgaccagtggaataaggtgatcgagattctggga
accccctctctggagtttatgaaccgtttgatggagactgtaaggaactatgtgatgaac
aaaccccagtttcctggagtcagttttaatgagctttttcccgactgggccttcccatca
gagacggagcatgacaagatcaaaacaagtcaagcacgagatctgctttccaagatgctg
gtaatcgaccctgaatgccgtatctctgtgcaggaggctcttaatcacccctacattcat
gtgtggtacgacccagctgaggctgatgcgcctcctccacagatctcagacaagcagctt
gaggagcgggaacacagcatcgagcagtggaaagagttgatttataaagaagtaatggac
tgggaggagcggaacaagaatggggtactgaaagaggagtgtttagacggtacggttaac
agcagcgccactccctcccagtcgtcctctattaatgacatctcatccatgtcgacggag
cagacgctggcttcagataccgacagctcttgcattgacaccctcacgggcccattggaa
gagtga

KEGG   Danio rerio (zebrafish): 562720
Entry
562720            CDS       T01004                                 

Gene name
mapk8a
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04141  Protein processing in endoplasmic reticulum
dre04210  Apoptosis
dre04217  Necroptosis
dre04310  Wnt signaling pathway
dre04510  Focal adhesion
dre04530  Tight junction
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    562720 (mapk8a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    562720 (mapk8a)
   04012 ErbB signaling pathway
    562720 (mapk8a)
   04310 Wnt signaling pathway
    562720 (mapk8a)
   04068 FoxO signaling pathway
    562720 (mapk8a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    562720 (mapk8a)
   04137 Mitophagy - animal
    562720 (mapk8a)
  09143 Cell growth and death
   04210 Apoptosis
    562720 (mapk8a)
   04217 Necroptosis
    562720 (mapk8a)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    562720 (mapk8a)
   04530 Tight junction
    562720 (mapk8a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    562720 (mapk8a)
   04621 NOD-like receptor signaling pathway
    562720 (mapk8a)
   04622 RIG-I-like receptor signaling pathway
    562720 (mapk8a)
   04625 C-type lectin receptor signaling pathway
    562720 (mapk8a)
  09152 Endocrine system
   04910 Insulin signaling pathway
    562720 (mapk8a)
   04920 Adipocytokine signaling pathway
    562720 (mapk8a)
   04912 GnRH signaling pathway
    562720 (mapk8a)
   04914 Progesterone-mediated oocyte maturation
    562720 (mapk8a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    562720 (mapk8a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    562720 (mapk8a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     562720 (mapk8a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   562720 (mapk8a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like DUF530
Other DBs
NCBI-GeneID: 562720
NCBI-ProteinID: NP_001103859
ZFIN: ZDB-GENE-080218-17
Ensembl: ENSDARG00000031888
Vega: OTTDARG00000029752
UniProt: A8WG58
LinkDB
Position
13
AA seq 427 aa
MNKNKREKEFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDNNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGSDHIDQWNKVIEQ
LGTPTQEFLLKLNQSVRTYVENRPRYTGYSFEKLFPDVLFPADSEHSKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPAEVEAPSPLITDKQLDEREHTVEEWKELIYKEV
LDWEERMKNGVIRGQPSPLGAAVINGSPQPSSSSSINDVSSMSTEPTVASDTDSSLEASA
GPLSCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaacaaaaataagcgagagaaagaattctacagtgtagatgtgggggattcgacattc
acagtgttgaagcgctatcagaatctaagacccattggctcgggtgctcagggaatagtc
tgctcagcgtatgacaacaacctcgagcgaaacgtggctataaagaaactcagccggcct
tttcaaaatcaaactcatgccaaacgtgcgtacagagagctggtgctcatgaaatgtgtc
aaccataaaaatataataggcctcttaaatgtttttacaccgcaaaaaacattagaagaa
ttccaagatgtttacctagtaatggagctgatggatgcgaacctctgccaagtcattcag
atggagctggaccacgagcggctgtcctatctgctgtaccagatgctgtgtggaataaaa
cacctccacgcggcggggatcatccacagggacctgaaacccagtaacatcgtggtaaag
tcagactgtaccctgaagatcctggatttcggtctggcgcggacagcagctacaggtctg
ctgatgacaccatatgtggtgacccgttactacagagcccctgaagtcatcctgggaatg
ggatatcaagccaatgtggatgtgtggtctgtcggctgtatcatggctgaaatggtcaga
ggtagtgtattatttccgggttcagatcatattgatcagtggaataaagtaatagagcag
ctgggaacgccaactcaggagttcttgttgaaactcaaccagtctgtgcggacctatgtg
gagaacaggccccggtacactggatatagctttgagaagctgtttcctgatgtcctgttc
cctgctgattcagaacacagcaaactaaaagcgagtcaggcgcgggacctgctgtctaaa
atgctggtgattgatgcatcaaaacgaatctcggtggatgaggctttgcagcacccctac
attaacgtgtggtacgacccggctgaagtggaagcgccttctcctctgatcacagacaaa
cagctcgatgagagggaacacacagtggaagagtggaaagaactgatctataaagaagtg
ctggattgggaagaacggatgaagaacggtgttattcgaggtcagccctcccccctaggt
gcagcagtgatcaacggctcaccccagccctcatcctcatcctccatcaacgacgtgtcc
tccatgtccacagagcccaccgtggcctcagacacagacagcagcttagaggcctcggcg
ggacccctgagctgctgcagatga

KEGG   Danio rerio (zebrafish): 569698
Entry
569698            CDS       T01004                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform 2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04141  Protein processing in endoplasmic reticulum
dre04210  Apoptosis
dre04217  Necroptosis
dre04310  Wnt signaling pathway
dre04510  Focal adhesion
dre04530  Tight junction
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    569698 (mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    569698 (mapk10)
   04012 ErbB signaling pathway
    569698 (mapk10)
   04310 Wnt signaling pathway
    569698 (mapk10)
   04068 FoxO signaling pathway
    569698 (mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    569698 (mapk10)
   04137 Mitophagy - animal
    569698 (mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    569698 (mapk10)
   04217 Necroptosis
    569698 (mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    569698 (mapk10)
   04530 Tight junction
    569698 (mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    569698 (mapk10)
   04621 NOD-like receptor signaling pathway
    569698 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    569698 (mapk10)
   04625 C-type lectin receptor signaling pathway
    569698 (mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    569698 (mapk10)
   04920 Adipocytokine signaling pathway
    569698 (mapk10)
   04912 GnRH signaling pathway
    569698 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    569698 (mapk10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    569698 (mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    569698 (mapk10)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     569698 (mapk10)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   569698 (mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 569698
NCBI-ProteinID: NP_001032790
ZFIN: ZDB-GENE-051120-117
Ensembl: ENSDARG00000102730
Vega: OTTDARG00000031282
UniProt: Q32LV0 A4QP40
LinkDB
Position
21
AA seq 430 aa
MNRRFLYNCSAPVLDVKIAFCQGFGKQVDVSYIAQHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYIN
VWYDPAEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKG
QPSPSAQVQP
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgaacagacgtttcttatataactgcagtgctccagtcctggatgtgaagattgccttt
tgtcagggttttggcaaacaagttgatgtttcttacattgcccagcattacaacatgagc
aaaagcaaagtggacaaccagttctacagtgtggaagtaggagattccaccttcacggtt
ctcaaacggtaccaaaatctaaagcccattggttctggggctcagggaatagtgtgtgct
ggatatgatgccgtcctggacagaaatgtggccattaagaaactcagcagacccttccag
aaccagactcatgctaagagagcgtatcgagagctggtgcttatgaagtgtgtcaaccac
aaaaacatcatcagcttattaaacgtcttcacaccacagaagtctttagaggaattccaa
gacgtttacctggtcatggagctgatggatgcaaacctctgccaggtcattcagatggag
ctggaccatgagagaatgtcctaccttctctaccagatgctgtgtggaatcaaacacctg
cattcagctggcattatccacagggatttgaaacctagcaatattgtggtgaaatccgac
tgcacgctgaagattttggatttcggcttggcaagaactgctggaactagttttatgatg
accccctatgtggtgacgcggtactacagggccccggaggtcattctgggcatgggctac
aaggagaacgtggatatttggtcagttggttgcatcatgggagaaatggtgcgccacaaa
atcctattccccggcagggactacatcgaccaatggaataaggttatagagcagctgggc
acgccctctcctgagtttatgaagaagctgcagccgacggtgcgcaactatgtggagaac
aggccaaaatacgccggtctgacctttcccaaactctttcctgactgcctgttccctgca
gactctgagcacaacaaactcaaagcgagtcaggcacgagacttgctgtcaaagatgctg
atcattgatccagcgaagcgaatatcagtggacgaggcgcttcaacacccctacatcaac
gtgtggtacgacccggctgaggtggaggcggccaggaatcagcagatatcgatgcctcct
ccacagatctatgataaacagctagatgagagggaacactctattgatgaatggaaagag
ctcatctataaagaggtgatgaacttcgaggagagaacaaagaatggtgtggtgaaggga
cagccctctccctcagcgcaggtgcagccgtga

KEGG   Danio rerio (zebrafish): 65236
Entry
65236             CDS       T01004                                 

Gene name
mapk8b
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04141  Protein processing in endoplasmic reticulum
dre04210  Apoptosis
dre04217  Necroptosis
dre04310  Wnt signaling pathway
dre04510  Focal adhesion
dre04530  Tight junction
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    65236 (mapk8b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    65236 (mapk8b)
   04012 ErbB signaling pathway
    65236 (mapk8b)
   04310 Wnt signaling pathway
    65236 (mapk8b)
   04068 FoxO signaling pathway
    65236 (mapk8b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    65236 (mapk8b)
   04137 Mitophagy - animal
    65236 (mapk8b)
  09143 Cell growth and death
   04210 Apoptosis
    65236 (mapk8b)
   04217 Necroptosis
    65236 (mapk8b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    65236 (mapk8b)
   04530 Tight junction
    65236 (mapk8b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    65236 (mapk8b)
   04621 NOD-like receptor signaling pathway
    65236 (mapk8b)
   04622 RIG-I-like receptor signaling pathway
    65236 (mapk8b)
   04625 C-type lectin receptor signaling pathway
    65236 (mapk8b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    65236 (mapk8b)
   04920 Adipocytokine signaling pathway
    65236 (mapk8b)
   04912 GnRH signaling pathway
    65236 (mapk8b)
   04914 Progesterone-mediated oocyte maturation
    65236 (mapk8b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    65236 (mapk8b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    65236 (mapk8b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     65236 (mapk8b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   65236 (mapk8b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like
Other DBs
NCBI-GeneID: 65236
NCBI-ProteinID: NP_571796
ZFIN: ZDB-GENE-010202-1
Ensembl: ENSDARG00000009870
Vega: OTTDARG00000020657
UniProt: Q9DGD9
LinkDB
Position
12
AA seq 384 aa
MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSIGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFMMKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSDHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEVEAPPPAITDKQLDEREHSVEEWKELIYKEV
LEWEERTKNGVIRGQPASLAQVQQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaacaggaataagcgcgagaaagaatattacagcatagatgtaggagattcaacgttc
accgttttgaagcgctatcagaatttaagaccaatcgggtccggagcacaaggcatcgtc
tgctcagcgtatgaccacgtcctcgatcgaaatgtggcaattaagaaactcagccgaccc
tttcaaaaccaaactcatgccaaacgggcctacagagaactggtcctgatgaaatgcgtc
aaccacaaaaatataattggcttactaaacgtgttcacaccacagaagacacttgaagag
ttccaggatgtttatctggtgatggagctgatggatgcaaacctgtgtcaggtgattcag
atggagctggaccacgagaggctgtcctacctgctctatcagatgctctgcggcattaaa
cacctgcacgctgctggcatcatacacagggatctgaaacccagtaatatagtagtgaaa
tcggactgcacgctgaagatcctggatttcggtctggcccgaacggctgcaaccggcctc
ctcatgactccttatgtcgtgacacgctattatcgggccccagaggtcatcctgggcatg
ggttatcaagctaacgttgatgtctggtctattggctgcatcatggctgaaatggtcaga
ggtagtgtgttgtttcctggcacagaccatattgaccagtggaataaagtgatcgagcag
ctgggcacgccgtcacaggagttcatgatgaagctgaatcagtctgtgaggacgtatgtg
gagaaccggcctcggtatgcgggatacagctttgagaagctcttcccagacgtgctcttc
cccgcagactcggaccacaacaaactcaaggcgagtcaggcacgagacttgttatccaaa
atgctggtaatagatgcatccaagcggatctctgtagacgaggcgcttcagcacccctac
atcaacgtttggtacgacccatcagaagtggaggcgccgccaccagcgatcacggataaa
cagctcgatgagagagaacactcagtggaagagtggaaagagctcatatacaaggaagtg
ctggaatgggaggagcgaacaaaaaatggagtgatcagaggacagccggcctcgctagca
caggtgcagcagtga

DBGET integrated database retrieval system