KEGG   Danio rerio (zebrafish): 100149794
Entry
100149794         CDS       T01004                                 

Gene name
akt3b
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100149794 (akt3b)
   04012 ErbB signaling pathway
    100149794 (akt3b)
   04370 VEGF signaling pathway
    100149794 (akt3b)
   04371 Apelin signaling pathway
    100149794 (akt3b)
   04068 FoxO signaling pathway
    100149794 (akt3b)
   04150 mTOR signaling pathway
    100149794 (akt3b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100149794 (akt3b)
  09143 Cell growth and death
   04210 Apoptosis
    100149794 (akt3b)
   04218 Cellular senescence
    100149794 (akt3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100149794 (akt3b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100149794 (akt3b)
   04625 C-type lectin receptor signaling pathway
    100149794 (akt3b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100149794 (akt3b)
   04920 Adipocytokine signaling pathway
    100149794 (akt3b)
   04914 Progesterone-mediated oocyte maturation
    100149794 (akt3b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100149794 (akt3b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100149794 (akt3b)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100149794 (akt3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100149794 (akt3b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100149794 (akt3b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100149794 (akt3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C APH
Other DBs
NCBI-GeneID: 100149794
NCBI-ProteinID: XP_001923454
ZFIN: ZDB-GENE-110309-3
Ensembl: ENSDARG00000087205
Vega: OTTDARG00000036907
UniProt: E7EXT6
LinkDB
Position
1
AA seq 479 aa
MNDLNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEERDEWVEAIQMVADKLAKQEEEGILCS
PISQIENVNEEEMDTSTSHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFTALDWQDVYDKKLVP
PFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADSERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaacgacctgaacgtcgtgaaagagggatgggtgcagaaaagaggtgagtacattaag
aactggaggccgcggtacttcctgttaaagacggacggctcgtttattggctataaagag
aagccgcaggatgcagatctggcgtatccgctcaacaacttctctgtcgccaagtgtcag
ctgatgaagactgagagaccgaaaccaaacaccttcatcatcaggtgtctgcagtggacc
actgtgatcgagcgcaccttccatgtcgacacgccagaggagagggacgagtgggtcgag
gccattcagatggtggcagacaagctggccaaacaggaggaagaaggaatcctgtgtagc
ccaatttctcagattgaaaacgtcaacgaggaggagatggacacgtcaaccagtcatcac
aaacgaaagacaatgaatgactttgactatctgaagctgctgggtaaaggcacgttcggg
aaggtgattctggtgcgagagaaagccagcggcacgtattatgcaatgaagatcctgaaa
aaggaggttattattgccaaggatgaagttgctcacacactcacggagagcagagttttg
aagaacactaggcacccatttctaacttcactgaagtattcctttcagacgaaggatcga
ttatgttttgttatggagtatgtgaatggaggagagttgttttttcatttgtcgagagaa
cgagtgttttcggaggacagaacccgattctacggcgctgagatcgtttccgcgttagat
tacttacactcagcgaagattgtttaccgagacctgaagctggaaaacctgatgttggat
aaagacggtcacataaagatcactgatttcggcctgtgtaaggagggcatcacggacgcc
gccaccatgaagacgttctgtgggaccccggagtatttagcccctgaggtattggaggac
aatgattacggtagagccgtggactggtggggtctaggagtcgtcatgtatgagatgatg
tgtggacgtctgcccttttataaccaggatcacgagaagctgtttgagctgattctgatg
gaggagatcaaatttcccagaactctctctgctgatgctaagtctttactgtctggctta
ctcatcaaggaccccaataagaggctcggaggaggcccggatgatgctaaagaaatcatg
agacacagtttcttcacggcgctggactggcaggacgtctacgacaaaaagctggtgccg
ccattcatgccccaggtctcttcagaaacagacaccagatatttcgacgaggagttcaca
gcgcagaccatcaccatcactcctccagagaaatatgatgaggacgggatggacgcggcc
gatagcgaaaggagaccacatttcccacaattctcgtattcggccagcgggcgggagtga

KEGG   Danio rerio (zebrafish): 101910198
Entry
101910198         CDS       T01004                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101910198 (akt1)
   04012 ErbB signaling pathway
    101910198 (akt1)
   04370 VEGF signaling pathway
    101910198 (akt1)
   04371 Apelin signaling pathway
    101910198 (akt1)
   04068 FoxO signaling pathway
    101910198 (akt1)
   04150 mTOR signaling pathway
    101910198 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101910198 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    101910198 (akt1)
   04218 Cellular senescence
    101910198 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101910198 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101910198 (akt1)
   04625 C-type lectin receptor signaling pathway
    101910198 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101910198 (akt1)
   04920 Adipocytokine signaling pathway
    101910198 (akt1)
   04914 Progesterone-mediated oocyte maturation
    101910198 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101910198 (akt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101910198 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101910198 (akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    101910198 (akt1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101910198 (akt1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101910198 (akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like Seadorna_VP7 Pkinase_fungal FTA2 PH_11 KELK APH
Other DBs
NCBI-GeneID: 101910198
NCBI-ProteinID: NP_001268730
ZFIN: ZDB-GENE-130730-1
UniProt: M4MD44
LinkDB
Position
17
AA seq 474 aa
MATDVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQ
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEERQEWTKAIQTVAESLQKQEEEMMD
ASAEHTDMETSLSKPPHKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVI
VAKDEVAHTLTENRVLQNSRHPFLTALKSSFQTHDHLCFVMEYANGGELFFHLSRERVFS
EERACFYGAEIVSALHYLHSERNVVYRDLKLENLMLDKDGHVKITDFGLCKEGITDGATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEDI
RFPRTLAPDAKSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFTGIVWQDVYEKKLVPPFK
PQVTSETDTRYFDEEFTGQTITITPPGQDDCMEAFDSERRPHFPQFSYSASGTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggcgacagatgtggtgatcgtgaaggagggatggctgcacaagagaggggagtatata
aagacatggaggccgcggtacttcttgctgaagagtgacggtacgtttatcggctataag
gagcgaccgcaagatgtggatcagctggagacgccgctcaacaacttctctgtggcccaa
tgtcagctgatgaagacggagcgaccgaaaccaaacacattcatcatacgctgcctgcag
tggaccactgtcattgagcgcaccttccacgtggagacgcctgaagaaaggcaggaatgg
accaaagccatccagactgtggcggagagtctgcagaaacaagaggaggagatgatggac
gcgtcagcagaacacacagacatggagaccagtctgagcaaaccaccacacaaagtgact
atgcatgacttcgaatacctcaaactcctgggaaaaggcacttttgggaaggtgattctg
gtgaaggagaaagcaacaggcaaatattacgccatgaaaatcctcaagaaagaagtgatc
gttgccaaagatgaagttgctcacacactgacagagaaccgagtgctgcagaactccaga
cacccgttcctgacggctctgaagtcatcgttccagactcatgatcacttgtgttttgtg
atggagtacgcaaatggaggagagcttttcttccacttgtctcgagagcgtgtgttctca
gaggagcgagcgtgtttctacggggctgagatcgtgtctgcgctgcactacctgcactcc
gaaagaaacgtggtctaccgggacctgaagctggagaacctgatgctggataaagacgga
cacgtaaagatcacagatttcggcttgtgtaaagaggggatcacagacggagccactatg
aagaccttctgcgggactccagagtatctggcgcccgaggtgctggaggacaatgattac
ggtcgtgcggtggactggtggggtttaggggtggtgatgtatgagatgatgtgtggccgt
ctgccgttctacaaccaggaccacgagcgtctgtttgagctcatcctgatggaggacatc
cgcttccctcgaaccctcgcccctgacgccaaatccctgctctccggccttctcaagaaa
gaccccatgcagcggttaggtggaggtcctgatgatgcgaaagaaatcatgcagcacaag
ttcttcactggaatcgtgtggcaggacgtctacgagaagaagttggttcctccgttcaag
ccgcaggtgacatcagaaacagacaccagatactttgatgaagagtttacaggacagacg
atcaccatcacaccacctggacaagatgactgtatggaggcatttgacagcgagagacga
ccacatttcccacaattctcatactcggccagcggaacagcatga

KEGG   Danio rerio (zebrafish): 378972
Entry
378972            CDS       T01004                                 

Gene name
akt2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    378972 (akt2)
   04012 ErbB signaling pathway
    378972 (akt2)
   04370 VEGF signaling pathway
    378972 (akt2)
   04371 Apelin signaling pathway
    378972 (akt2)
   04068 FoxO signaling pathway
    378972 (akt2)
   04150 mTOR signaling pathway
    378972 (akt2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    378972 (akt2)
  09143 Cell growth and death
   04210 Apoptosis
    378972 (akt2)
   04218 Cellular senescence
    378972 (akt2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    378972 (akt2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    378972 (akt2)
   04625 C-type lectin receptor signaling pathway
    378972 (akt2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    378972 (akt2)
   04920 Adipocytokine signaling pathway
    378972 (akt2)
   04914 Progesterone-mediated oocyte maturation
    378972 (akt2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    378972 (akt2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    378972 (akt2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    378972 (akt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    378972 (akt2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     378972 (akt2)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   378972 (akt2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 378972
NCBI-ProteinID: NP_937789
ZFIN: ZDB-GENE-031007-5
Ensembl: ENSDARG00000011219
Vega: OTTDARG00000013516
UniProt: Q8UUX0
LinkDB
Position
18
AA seq 479 aa
MNEISVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPETSDANQPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSNSEREEWIRAIQAVANGLKSREEDEPMD
INFGSPGDNSLEGMEAAITKSRTKVTMSDFDYLKLLGKGTFGKVILVREKATGMYYAMKI
LRKEVIIAKDEVAHTITESRVLQNTRHPFLTTLKYAFQTRDRLCFVMEYANGGELFFHLS
RERVFTEDRARFYGAEIVSALEYLHSKDVVYRDLKLENLMLDKDGHIKITDFGLCKEGIT
NEATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPRNLSPEAKALLAGLLKKDPKQRLGGGPEDAKEVMTHKFFNNMNWQDVLQKKL
VPPFKPQVTSETDTRYFDDEFTAQTITVTPPDQYDSLDAEDPDTRTHFSQFSYSASVRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaacgagatcagcgtcgtcagagagggctggctccacaagagaggtgaatacattaag
acttggaggcctcgatatttcatcctaaagagtgatggctcttttatcggctacaaggag
aagccggagacgtcagacgccaatcagccacctctcaataacttctctgtcgcagaatgt
cagctgatgaagactgaacgacctcggccaaacacttttgtcattcgttgcttgcagtgg
accactgttatcgagcgcacctttcatgtggacagcaattctgaaagagaggagtggata
cgtgccatccaggctgtggccaacgggctcaagtcccgggaagaggatgagccaatggat
atcaactttggctcccctggagacaacagtctagaggggatggaggctgccatcacaaag
tcccgcaccaaagtgaccatgagtgactttgactacttaaagctgctgggtaaaggcact
tttggtaaggttattctagtgagggagaaggctactggcatgtactacgccatgaagatc
ctacgcaaagaggtcatcatcgctaaggacgaagttgcacacacaatcacagaaagcaga
gtgttgcagaacacacggcatcctttccttacaacactaaaatacgccttccagacgcga
gatcgactgtgtttcgtcatggagtacgcaaatggaggcgagctgttcttccacttgtct
cgagagcgcgtgtttacggaggacagagctcgcttctatggggcagaaatcgtttcagcg
ttggagtatctgcactctaaagatgtcgtctacagggacctaaagctggagaatctaatg
ctggataaagatggtcacattaaaatcacagactttggcctgtgtaaagagggcattact
aatgaggccaccatgaagacattctgtgggaccccagagtaccttgctcctgaggtatta
gaagacaatgattatggccgtgcagtggactggtggggtcttggagtggtaatgtatgaa
atgatgtgcggtcggctgccgttctacaaccaggaccacgagcgtctgtttgagctcatt
ttaatggaggagattcgcttccccagaaacctctcacccgaggccaaagcactgctggcc
ggccttctcaaaaaagaccccaaacagaggcttggcggaggtcctgaagatgccaaagaa
gtgatgacacacaagttcttcaacaacatgaactggcaagatgtgcttcaaaagaagctc
gttccacccttcaagccgcaagtgacctcagagacagacacacgctactttgatgatgag
ttcactgcacagaccattactgtcactccacctgaccaatatgacagtcttgacgcggag
gacccagatacacgcacacacttctcccagttctcctactcagccagtgtgcgggagtga

KEGG   Danio rerio (zebrafish): 403146
Entry
403146            CDS       T01004                                 

Gene name
akt2l
Definition
(RefSeq) v-akt murine thymoma viral oncogene homolog 2, like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403146 (akt2l)
   04012 ErbB signaling pathway
    403146 (akt2l)
   04370 VEGF signaling pathway
    403146 (akt2l)
   04371 Apelin signaling pathway
    403146 (akt2l)
   04068 FoxO signaling pathway
    403146 (akt2l)
   04150 mTOR signaling pathway
    403146 (akt2l)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    403146 (akt2l)
  09143 Cell growth and death
   04210 Apoptosis
    403146 (akt2l)
   04218 Cellular senescence
    403146 (akt2l)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    403146 (akt2l)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    403146 (akt2l)
   04625 C-type lectin receptor signaling pathway
    403146 (akt2l)
  09152 Endocrine system
   04910 Insulin signaling pathway
    403146 (akt2l)
   04920 Adipocytokine signaling pathway
    403146 (akt2l)
   04914 Progesterone-mediated oocyte maturation
    403146 (akt2l)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    403146 (akt2l)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    403146 (akt2l)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    403146 (akt2l)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    403146 (akt2l)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     403146 (akt2l)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   403146 (akt2l)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 403146
NCBI-ProteinID: NP_997980
ZFIN: ZDB-GENE-040121-5
UniProt: Q802Y3
LinkDB
Position
10
AA seq 478 aa
MTELSVVKEGWLLKRGEYIKTWRPRYFILKSDGSFIGYKEKPELTDQSYAPLNNFSVEEC
QLMKTERPRPNTFMIRCLQWTTVIERTFHVDSSDERDEWMRAIQMVANGLQARDVDEPME
IKYSSPSDALEDMEMCLSKSSSRVTMNDFDYLKLLGKGTFGKVILVREKASGMYYAMKIL
RKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHLSR
ERVFSEDRARFYGAEIVSALDYLHSQNVVYRDLKLENLMLDNDGHIKITDFGLCKEGITD
EATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYSQDHERLFEQIV
MEEIRFPRSLSTHARALLTGLLRKEPKQRLGGGPDDARDVMMHKFFSGVQWDDVLQKKLL
PPFKPQVTSETDTRYFDDEFTAQSITVTPPDKLSCQDVEESGPIAHFPQFSYSASVRE
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgacagagctcagtgtggtgaaggagggctggctccttaagagaggtgagtacatcaag
acatggaggccgcggtacttcatcctgaagagtgacggctccttcatcggctacaaggag
aagccggagctgacggaccagagctatgcaccgctcaacaacttctctgtggaggagtgt
cagctgatgaagacggagcgtccgcggccgaacaccttcatgatccgctgcctgcagtgg
accaccgtcattgagcgcaccttccatgtggacagcagtgacgagagggacgagtggatg
cgagcaatccagatggtggccaatgggctgcaggcgcgggatgtggacgagccaatggag
atcaagtacagctctcccagtgacgctctggaggacatggagatgtgtctgtccaaatcc
agctccagagtgacgatgaatgactttgattacctgaagctgctggggaagggcacgttt
gggaaggtgattctggtgcgggagaaggcctctgggatgtactacgccatgaagatcctg
cgcaaggaagtgatcatcgcgaaggatgaagtggcgcacacagtcacagagagtcgagtg
ctgcagaacactagacaccccttccttacgaccctcaaatacgccttccagactcatgac
cgtctgtgtttcgtgatggagtacgccaacggtggagagctattcttccatctgtctcgt
gagcgtgtgttctctgaggatagagctcgcttctacggcgctgagatcgtctctgctctg
gactatctgcactcacagaacgtggtctacagagacctgaagctggagaacctcatgctg
gataatgacggacacattaaaatcacagacttcggtctctgtaaagagggaatcacagac
gaggccaccatgaggaccttctgcgggaccccagaataccttgcgccggaggtgctggag
gacaatgattacggccgtgcggtggactggtggggtctgggtgtggtgatgtatgagatg
atgtgtggccgtctgccgttctacagtcaagaccacgagcgtctgttcgagcagatcgtg
atggaggagatccgcttcccccgcagcctgagcacacacgccagagcactgttgaccggc
ctgctgaggaaagagcccaagcagaggctcggcggaggcccagatgatgccagagatgtg
atgatgcacaagttcttcagcggcgttcagtgggacgatgtgctgcagaagaagctgctg
ccgccctttaaaccgcaggtgacgtcagagacggacacacgctactttgatgatgagttc
actgcgcagagcattactgtgacccctccagacaagctgagctgtcaggacgtggaggag
tctgggccgatcgcacatttccctcagttctcctactccgccagcgtccgagagtga

KEGG   Danio rerio (zebrafish): 560549
Entry
560549            CDS       T01004                                 

Gene name
akt3a
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04620  Toll-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre05132  Salmonella infection
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    560549 (akt3a)
   04012 ErbB signaling pathway
    560549 (akt3a)
   04370 VEGF signaling pathway
    560549 (akt3a)
   04371 Apelin signaling pathway
    560549 (akt3a)
   04068 FoxO signaling pathway
    560549 (akt3a)
   04150 mTOR signaling pathway
    560549 (akt3a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    560549 (akt3a)
  09143 Cell growth and death
   04210 Apoptosis
    560549 (akt3a)
   04218 Cellular senescence
    560549 (akt3a)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    560549 (akt3a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    560549 (akt3a)
   04625 C-type lectin receptor signaling pathway
    560549 (akt3a)
  09152 Endocrine system
   04910 Insulin signaling pathway
    560549 (akt3a)
   04920 Adipocytokine signaling pathway
    560549 (akt3a)
   04914 Progesterone-mediated oocyte maturation
    560549 (akt3a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    560549 (akt3a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    560549 (akt3a)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    560549 (akt3a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    560549 (akt3a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     560549 (akt3a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   560549 (akt3a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 APH
Other DBs
NCBI-GeneID: 560549
NCBI-ProteinID: NP_001184130
ZFIN: ZDB-GENE-050419-180
Ensembl: ENSDARG00000104810
Vega: OTTDARG00000042061
UniProt: D9IL79
LinkDB
Position
13
AA seq 479 aa
MSDVTVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEERDEWAEAIQMVADKLQRQEEERIQCS
PTSQIDNMGEEEMDTSISHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFTGIDWQDVYDKKLIP
PFKPQVSSETDTRYFDEEFTAQTITITPPEKFDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccgtcgtcaaggaaggctgggtccagaagagaggtgaatatattaag
aattggagacctcggtacttcctgctcaaaacagacggatcctttatcggatacaaggag
aagccacaggatgcagatcttccctatcctctcaataacttctctgttgcaaaatgccag
ctgatgaaaactgaacgaccaaagccgaacacttttattattagatgcctacagtggact
acagtcatagagaggaccttccatgtggacacaccagaggagagggatgagtgggcagag
gcgatccagatggtggcagataaactccaaagacaggaagaggagcgaatccagtgtagt
cccacctcacagatagacaacatgggagaggaggagatggacacgtctatcagccaccac
aaacgcaagacaatgaatgactttgactacttaaaattactgggaaaaggcacttttgga
aaagtcattctcgtaagggagaaggccagcgggaaatattatgcaatgaaaattttaaag
aaagaagttattatagcaaaggacgaagtggcccacacgctcacagaaagcagagtactg
aaaaacaccagacatccttttttaacctctttgaagtactcgttccaaacaaaagaccgc
ctatgcttcgtgatggagtatgtcaatggaggagagctgtttttccatttgtcgagagaa
cgggtgttctcggaggaccgcacgcgcttctacggcgccgagatcgtttccgccctcgac
tacctgcactctgccaagattgtgtaccgggatctcaagctggagaatttgatgcttgat
aaagatggtcacatcaaaattacagactttggcctctgcaaagaaggaatcactgatgct
gctaccatgaagaccttctgtgggacgccagagtatttggcaccggaggtgctggaggac
aatgattacggccgtgcggtggactggtggggtctcggggtggtcatgtatgagatgatg
tgtggtcgactgcctttctacaatcaggaccacgagaagctgtttgagctcatcctgatg
gaggacatcaagttccccaggacgctctccgctgatgccaagtccctgctgtccggcctg
ctcatcaaagatcccaacaagagacttggtggaggtccggatgatgctaaggaaattatg
cgacatagtttctttactggaattgactggcaggatgtctatgataaaaagctgatacct
cccttcaagcctcaggtgtcgtcagagacagataccagatattttgatgaagagttcaca
gctcaaaccattacaataacccctcctgaaaaatttgatgaagatgggatggactgcatg
gacaacgagcgacggccacacttcccccagttctcctactcggccagcgggagagaatga

DBGET integrated database retrieval system