KEGG   Danio rerio (zebrafish): 100170813Help
Entry
100170813         CDS       T01004                                 

Gene name
galnt18a
Definition
(RefSeq) UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 18a
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100170813 (galnt18a)
   00514 Other types of O-glycan biosynthesis
    100170813 (galnt18a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100170813 (galnt18a)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100170813 (galnt18a)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   100170813 (galnt18a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C 4HB_MCP_1
Motif
Other DBs
NCBI-GeneID: 100170813
NCBI-ProteinID: NP_001124120
ZFIN: ZDB-GENE-080723-30
Ensembl: ENSDARG00000100889
Vega: OTTDARG00000039355
UniProt: B3DHD4
LinkDB All DBs
Position
25
AA seq 609 aa AA seqDB search
MACTRRTKTLVSTCVILSGMTNILCLLYVGWITNYVSNNGNVKVAGRTHEKKFDDDSKGE
TLRIIERLDRLESVVNQHIQEKPQSDIEDSADLSLSETLFAHWGHELGPESRKVALRKFQ
YYGYNAYLSDRLSLDRAVPDLRPDGCRNISYPTGLPQVSIIFIFVNEALSVILRSVHSVI
QRTPAHLLKEIILVDDHSNNAELLENLQRFVDETNQQQRDFIKVVHHEKQEGLIRSRVSG
WRAASAPIVALFDAHVEFSIGWAEPILHRIQEDRTRAISPSFDNIKYDTFEIEEYPLSAQ
GFDWELWCRYLNPPKSWWMQKNQTAPIRSPALIGCFVVDREYFEEIGLLDEGMEVYGGEN
VELGIRVWLCGGSVEVIPCSRIAHIERAHKPYTEDLATHVRRNALRVAEVWMDEFKSHVY
MAWNIPQQDSGIDIGDIRDRKALRERLRCKPFSWFLNNIYSEMRTYMDTIAYGVLRNSLR
PDLCVDQGPDSDNIPILYICHGLTPQNVYFTSSQQLHVGGLSPTIDDDDNKCLVDVNSRP
RLLECSYASNKHMKLSWLFTQGGSIQNKKSKRCLELVESADVDHGYQLVLQKCSSQKWTI
THILPGKVL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcacgaggagaaccaaaactttggtgtccacgtgcgtgattttaagtggcatg
accaatattctgtgcctgctgtacgtcgggtggatcaccaattatgtgtctaataacggc
aacgtcaaagttgcaggaaggacgcacgagaaaaagtttgacgatgacagcaaaggggaa
accttgaggattattgaaagactggacagacttgagagtgttgtaaatcaacacatccaa
gagaagccacagtcagatatcgaggactctgctgacctgtcactctcagagactttgttt
gcacactggggacatgagctggggccagagagccgaaaggtggccctcagaaagttccag
tactacggctataatgcctacctcagtgacagactctctttggacagagccgtgccagac
ctcagacctgacggctgcagaaatatctcatacccgacaggtctgcctcaggtcagcatc
atcttcatctttgtgaatgaggctctgtctgtgatcctgcgctctgttcattcagtgatt
cagaggacacctgctcacctgctgaaggagatcatcctcgtggacgaccacagcaacaac
gcagagctgctggagaatctgcagagatttgtggacgagaccaatcagcagcagcgtgac
tttattaaagtggtccaccatgagaagcaggagggattgattcgctctcgggtcagtgga
tggagagctgcaagtgccccaatcgtcgccctgtttgatgcccatgttgagttcagcatt
ggctgggctgaacctattcttcaccgcatccaagaggaccgaacgcgggccatctcgcca
tcatttgacaacatcaaatacgacacgtttgagattgaagagtatccactctctgctcaa
gggtttgactgggaactgtggtgccgttatttaaaccctcccaaatcctggtggatgcaa
aagaaccaaaccgcaccaatcaggagtcctgctctgatcggctgctttgtagtggatagg
gagtattttgaggagattggcctgctggatgaagggatggaggtttacggcggggagaac
gtggagctggggatcagggtttggttgtgtggaggaagtgtggaggtcataccctgctcc
agaatagctcatattgaacgcgcacacaagccctacacagaggatctggcaacccatgtg
cgcaggaacgctctaagggtggctgaggtatggatggatgagttcaagagccacgtttac
atggcctggaacattcctcaacaggactctgggattgatatcggtgatatcagagaccga
aaagctctcagagaaagactccgctgtaaacctttcagctggttcctcaacaatatttat
tctgagatgagaacctatatggacaccatcgcttatggtgtactgaggaacagcctgagg
ccggatctttgtgtggatcaaggtcccgactccgacaacattcccattctgtacatctgc
catggcctgacgcctcagaatgtgtacttcacaagctctcaacagttgcatgtcggagga
ttgagtccaactattgatgatgatgacaacaagtgcctggtggacgtgaacagccgacca
cgactgctggaatgcagctacgccagcaacaaacatatgaaactctcctggcttttcacc
cagggaggctccattcagaacaaaaagtcgaaacgttgtttggagttggtagaaagtgca
gatgtggatcatggatatcagctggtccttcagaagtgcagcagtcagaaatggacaatc
acccacatattgcctgggaaagttttatag

KEGG   Danio rerio (zebrafish): 100310831Help
Entry
100310831         CDS       T01004                                 

Gene name
galnt18b
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 18 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100310831 (galnt18b)
   00514 Other types of O-glycan biosynthesis
    100310831 (galnt18b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100310831 (galnt18b)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100310831 (galnt18b)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   100310831 (galnt18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C CDtoxinA
Motif
Other DBs
NCBI-GeneID: 100310831
NCBI-ProteinID: XP_003199061
ZFIN: ZDB-GENE-091014-1
Ensembl: ENSDARG00000059438
Vega: OTTDARG00000041243
UniProt: E7F4H6
LinkDB All DBs
Position
7
AA seq 609 aa AA seqDB search
MACTRRTKTLVSTCVILSGMTNIVCLLYVGWVTNYIANVYIKVPVPVPAKKLEGDRKGET
LRIIERLDRLENVVNQHIQESPLKGDDNQVDRSFADSSLFNHWGQDLGPESRRVALKMFQ
YYGYNGYLSDRLSMDRAIPDYRPDGCKNMSYPSNLPQVSIVFIFVNEALSVILRSIHSVM
NRTPSHLLKEIILVDDNSNNDELKEKLQDFVKETNAKQPGFIKVVRHSRQEGLIRSRVSG
WRAASAPVVALFDAHVEFNIGWAEPILQRIKEDRTRIISPSFDNIKYDTFEIEEYPLSAQ
GFDWELWCRYLNPPKSWWNLNNSTAPIRSPALIGCFVVDRLYFAEIGLLDEGMEIYGGEN
VELGVRVWQCGGSVEVLPCARIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVY
MAWNIPQEDSGIDIGDIAERKALRKKLQCKTFRWYLVNIYPEMRMYTDTVAYGVLRNSLK
TDLCLDQGPDTDNIPILYLCHGMTPQNVYYTSTQQLFVGILSPTVDDDDNKCLVDVNGRP
RLIECSYAVAKRMKLHWRFTQGGSIQNTKSKRCLELVENNDNEFGFQLTLQKCTGQNWTI
TNMLPGSTL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcaccagaagaaccaaaactttggtgtctacgtgtgtgatactaagtggcatg
accaacattgtgtgtcttttgtacgtcggatgggtgactaattacatcgctaatgtgtac
atcaaagtgccggtgcctgtcccggccaaaaagttggaaggcgacaggaaaggagaaact
ctgcggattatagagcgactggatcggctggagaatgttgtcaatcagcatatacaagag
tcgccactgaaaggagatgacaatcaagtggatcgatcttttgctgactcatccttgttt
aaccactggggccaagacctggggcctgagagccgtcgagtggccctcaagatgtttcag
tattacggctacaacgggtacctcagcgaccgcctctccatggacagagccatcccagac
tacaggccggacgggtgcaaaaacatgtcttacccgtccaacctgccacaagtcagtata
gtctttatctttgtgaacgaggcgctgtcggtcattctgcgctccatccattcagtcatg
aacagaacacccagccacctgctcaaagagatcatactggtcgacgacaacagcaataac
gatgagctaaaggagaagctgcaggactttgtaaaggagaccaacgctaagcagccgggt
ttcattaaggtggtccgtcacagtaggcaggagggtctgattcgctctcgagtgagtggc
tggagagccgcctctgcccctgtagtggctctttttgatgcccacgtggagttcaacatt
ggctgggctgagcctattctccaaaggatcaaagaagacagaaccagaattatatctcca
tcttttgacaacatcaaatacgacacatttgagattgaggagtatcccctctccgctcag
ggctttgactgggagctgtggtgccgctatctgaatccacccaaatcatggtggaaccta
aacaacagcactgctccaatcaggagtccggctctgatcggctgttttgtggtggaccgg
ctgtatttcgcagagatcggtctgctggatgaaggcatggagatttacggaggagagaac
gtggagctgggcgtcagggtgtggcagtgtggaggaagtgtggaggtgttgccctgtgcc
cgcatcgcccatatcgagcgcgcccacaaaccctacacagaggatctcactgcccacgtg
cgcagaaacgctctgagggttgcagaagtgtggatggacgagtttaaaagccatgtctac
atggcctggaacattccacaagaggactcagggatagacatcggtgacatcgccgaaaga
aaagcactgaggaaaaagctgcagtgcaagaccttccgctggtatctagtgaacatttac
cccgagatgagaatgtacacggacaccgtcgcatacggagtgctcagaaactctttgaag
actgacctgtgtctcgaccaagggccagacaccgacaacattcccatcctttacctctgt
cacgggatgacacctcagaatgtatactacaccagcactcagcagttatttgtgggcatc
ctgagccccaccgttgacgacgatgacaacaagtgcctggtggacgtgaacggccggccg
cggctcattgagtgcagctacgctgtggccaaacgcatgaagctccactggcgttttact
cagggaggctccatccagaatacaaagtcaaagcgatgccttgaactcgtggagaacaat
gacaatgagttcggatttcagctcaccctccaaaaatgcactggccagaactggaccatc
accaatatgttgcctggtagcaccttatga

KEGG   Danio rerio (zebrafish): 100330695Help
Entry
100330695         CDS       T01004                                 

Gene name
galnt13
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 13 isoform X3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100330695 (galnt13)
   00514 Other types of O-glycan biosynthesis
    100330695 (galnt13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100330695 (galnt13)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100330695 (galnt13)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   100330695 (galnt13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C Glyco_tranf_2_2 RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 100330695
NCBI-ProteinID: XP_002663357
ZFIN: ZDB-GENE-091204-444
Ensembl: ENSDARG00000099227
Vega: OTTDARG00000032767
UniProt: A0A286Y879
LinkDB All DBs
Position
9
AA seq 556 aa AA seqDB search
MRRFVYCKVVLTTSLVWVLVDVFLLLYFSECNKCDNRKDHSLLPALRAVMSRAHEAPGEM
GKAVVIPKEEQDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIV
IVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVPVRIL
RMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVI
SDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRT
YFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQV
INKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPD
SQIPRRYYSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDL
CLDASRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLKDCS
GRRSQQWILRNMTLGV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagacgcttcgtgtactgtaaggtggtcctgaccacctctctggtgtgggtgctagtg
gatgtcttcctcttgctatacttcagtgagtgcaacaaatgtgataaccggaaggaccat
tcactcctgcctgcgctcagagctgtgatgtcacgtgcccatgaggctccaggtgaaatg
gggaaggctgtggtgattcccaaagaagagcaggacaagatgaaagaactctttaaaatc
aatcagttcaacctgatggccagtgacatgatcgcgcttaacaggagtctgccagatgtc
aggctggatggctgtaagacgaagacctaccctgatgaccttccaaacaccagcattgtt
atcgtgtttcataatgaggcatggagtacactgctaagaaccgtacacagcgccataaac
cgctcgcccagacaactgctgtatgagatactgctggtggatgatgctagtgaaagagat
tttctaaaggaaaaattggaggactatgttgcaactctggaggttccggtgcgaattttg
aggatggagcagcgaactggtttgattcgagcaaggctgagaggggcagccgccacacga
ggacaggtcatcacctttctggatgcccactgtgagtgcactacaggctggctggagcct
ctgatggcacggatcaaagaggacaggagggctgtggtctgcccgattattgatgtcatc
agtgatgagacatttgagtacatggccggctcagatatgacctatgggggattcaactgg
aaactcaactttagatggtatccagttcctcagagagagatggaccgccgtaaaggggac
cggacccttcctgtaagaactcccacgatggcaggaggtctgttctctattgaccgaacg
tattttgaagagattggcacctatgactcagggatggatatatggggaggcgaaaatctt
gagatgtctttcaggatctggcaatgtggaggatctctagagatagtgacatgttctcac
gtcggacatgtgttccggaaagccacaccttacagctttccgggcgggactggtcaggtg
ataaacaagaacaacagacgattggctgaagtctggatggacgagtttaaagatttcttc
tacatcatctcaccaggtgtggttcgggtagattatggggatgtttcttctcggaaggct
ttgagagaatctctgaagtgcaaaccattctcatggtacctggagaacgtataccccgat
tctcagattccccgcagatattactccctcggggagatcaggaatgttgagaccaatcag
tgtgttgataacatgggccgtaaggagaatgaaaaggttggcttcttcaactgtcatgga
atgggaggaaaccaggtattttcatacactgctgacaaagaaatccgtacggatgacctg
tgtctggatgcatcacgactgaatggacctgttgttatgctgaagtgccaccacatgaag
ggaaaccagatgtttgaatatgatgcagagcgtctgactctgctccatgtgaacagtaac
cagtgtctggacatgccttctgaagaggataagatggttcccactctcaaagactgtagc
ggcaggcgctcacagcagtggatcttgaggaacatgacgctaggcgtctga

KEGG   Danio rerio (zebrafish): 100331984Help
Entry
100331984         CDS       T01004                                 

Gene name
galnt3
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100331984 (galnt3)
   00514 Other types of O-glycan biosynthesis
    100331984 (galnt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100331984 (galnt3)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100331984 (galnt3)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   100331984 (galnt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_3 Glyco_tranf_2_2 RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 100331984
NCBI-ProteinID: XP_021334717
ZFIN: ZDB-GENE-120313-1
Ensembl: ENSDARG00000108649
LinkDB All DBs
Position
9
AA seq 625 aa AA seqDB search
MTFIRRLLRRRLHPLKLAIVALVFVTFLFLMQREVVSQSPQDEPWLRGIVEKRDGVLGMV
MGAVNNFRDAMPKMQIKAPVRQQESQGSSACLSGYYTPAELKPVLERPPQNPSAPGASGK
AFHTDNLSSSEQKEKERGEEKHCFNLYASDRISLSRDLGPDTRPPECIEQTFRRCPPLPT
TSVIIVFHNEAWSTLLRTVYSVLHTSPALFLKEIILVDDASVDEHLKDKLDEFLKQLHIV
RVVRQHERKGLITARLLGASVATGDTLTFLDAHCECFHGWLEPLLARIAENSSAVVSPDI
TTIDLNTFEFMKPSPYGQHHNRGNFDWGLSFGWETLPDHERRRRKDETYPIKTPTFAGGL
FSISRDYFYHIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFP
KGTQVIARNQVRLAEVWMDDYKEIFYRRNQQAAQIAKEHSFGDVSRRVDLRERLQCKSFS
WYLKNVYPEVFMPDLNPLQFGAIRNMGKEACLDVGESNEGGKPLIMYPCHGMGGNQYFEY
STHHEIRHNIQKELCLDGTDGAMVRLEECQYKGHNTITSPQQKWELREDQLFYNKASKQC
LSARPENPSLVPCNPDDKYQLWLFT
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgactttcatccggaggcttctgcgcaggcgcctgcacccgctgaagctggccatcgtg
gcgctggtgttcgtgacctttctgttcctgatgcagagagaagtggtcagtcagagccct
caggacgagccctggctcagaggcattgtggagaagcgggatggtgttttggggatggtg
atgggagctgtgaataacttccgggatgcaatgccgaagatgcagattaaagctcctgtg
aggcagcaggaaagccagggcagttcagcttgtttatcagggtattacacgccggctgaa
ctcaaacccgtcttggaaaggccaccgcaaaaccccagtgccccgggtgcttctgggaag
gcttttcacactgacaatttgagctcatcggagcaaaaagaaaaggagcgaggagaggag
aagcactgctttaatctgtacgccagtgatcggatctcgctcagcagagacctcgggccg
gacaccagacctccagaatgcatcgaacagacgttcagacgctgtccacctctgccgacc
accagcgtgatcatcgtcttccacaatgaggcttggagtacattactgcgcaccgtctac
agcgtcctgcacacctcgccagctctgttcctcaaagagatcatcctggtggatgatgcc
agcgttgacgagcatctaaaggataaactggacgagtttctgaagcagctgcacattgtg
cgtgtggtccgtcagcatgagcgtaaaggattaatcactgcgaggctccttggggcctct
gtggccacaggagacactctcaccttcctggatgcccactgtgaatgtttccacggatgg
ctcgagccgctgttggccaggatagcagagaactcgagcgctgtcgtgagtccggacatc
accaccattgacctgaacacatttgagttcatgaaaccctcgccgtacggacagcatcat
aacagggggaacttcgactggggtctttccttcggctgggagactcttcctgatcatgag
aggcgtagacgcaaggatgagacgtaccctattaagacgccgacattcgcaggtggattg
ttctccatttccagagattatttctaccacataggaagctatgacgaggagatggagatt
tggggaggagaaaacattgagatgtccttcagagtgtggcagtgtggcggacagctagaa
atcatcccgtgttcagtcgtcggccacgtgtttcgcactaagagtccacacactttccct
aaaggcacacaggtgatcgctcgcaaccaggtgcgtctggccgaggtctggatggatgac
tataaagagatcttttaccggaggaaccagcaggccgctcaaatcgcaaaagagcactcg
ttcggagacgtctccaggcgtgtggatctccgggaaaggctccagtgtaagagcttttcc
tggtatttgaagaacgtttatccagaggtcttcatgcctgatctcaacccgttgcagttc
ggtgcgatcaggaacatggggaaggaagcctgtctggacgtgggtgagagtaatgaggga
gggaagcctctcatcatgtacccctgccatgggatgggaggaaaccagtattttgagtac
tccacgcatcacgagatcagacacaacatccagaaggagctgtgtttagatggaactgat
ggagcgatggtccgcttagaggagtgtcagtataaaggccacaacaccatcacaagcccg
cagcagaagtgggagctccgggaggatcagctgttctataacaaggcctcaaagcagtgt
ctgagcgctcgacccgagaacccctcactagtgccctgcaatccagacgacaaataccag
ctctggctcttcacttga

KEGG   Danio rerio (zebrafish): 100334784Help
Entry
100334784         CDS       T01004                                 

Gene name
galnt5
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 5
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100334784 (galnt5)
   00514 Other types of O-glycan biosynthesis
    100334784 (galnt5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100334784 (galnt5)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100334784 (galnt5)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   100334784 (galnt5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin GvpO
Motif
Other DBs
NCBI-GeneID: 100334784
NCBI-ProteinID: XP_002667267
LinkDB All DBs
Position
9
AA seq 768 aa AA seqDB search
MNFKKYLRGSGRVLAFVFIASVIWLIFDIVALRISFSDVNQDFKVREIILKQRRQDYADD
LIKYPLQKANLHKRKSLKNRLERKVDEVYRKGPKPESQNPLHGLASKSFVEQKEINQNKR
SASTPKKPNETKTIFNVKVSNLNARIDKINTVFNRQTEVKLNVNAHQFSKALAVVQQKVY
PDNTSVMSHYEINVDVGLQKNLSNDMLKPVEKLENNTDSRKKHAGTFKKTKSDITRKPSK
PTAQDPAEEALRVLPSTSVKRSGGHHKVKALDVTDRPRDPHAVGQFGQPARVPKNEELES
RRRWSEGFFNVFLSEQIPIDRAIPDTRPQTCSESLVHDDLPSTSVIFCFVDEVWSTLLRS
VHSVLNRSPPQLLKEIILVDDCSTKDYLKEQLDVYMSQFPKVRIIHLKERQGLIRARMAG
AAAATGEVLTFLDSHIECNVGWLEPLLERIYLDRRKVPCPVIDVINDKDMSYMLVDNFQR
GIFKWPLVFGWSALPEEYIQKNQIKDSDPIRIACCFIHSHILHNNRKKSGNVFLFVFQIW
MCGGEIEIIPCSRVGHIFRSDNPYKFTKDRVKTVERNLARVAEVWLDEYKEVFYGHGYQH
LLDKNVTDIGNLTEQIQLREKLKCKSFKWYLENVYPDLDTPVVKAEGLIFNVGTRKCLIF
QNESFSLTKCDLTNKSQYFTFTWLRLLRQNTSCLAPQETQLTMEPCDNTKPHLRWIHKSG
KALTEHLMAEVYSQPICLEAGIKADGVFLKGCDRFSTFQKWQFTHYYE
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaagaagtatttaagaggcagtgggagggtcctcgcgtttgtgtttattgca
tccgtaatttggctaatctttgatatcgtagcacttcgaatatccttcagtgatgtaaat
caagactttaaagtgagagaaattattctaaaacaaaggagacaagactatgcagatgat
ctgattaaatatccactgcaaaaagcaaacttgcacaagagaaagtctcttaaaaacagg
cttgaaagaaaagtggatgaggtttacagaaaagggccaaagccagaaagccaaaatcca
ttacatggcttggcaagcaaatcttttgtagaacaaaaggaaataaatcaaaataagagg
agtgccagcactcctaaaaaaccaaatgagacaaaaactatttttaatgtcaaagtgagc
aatttaaatgcaaggatcgataaaataaacactgtttttaatcgtcagacagaggtaaag
ctgaatgttaatgcacatcaattttcaaaagcactggctgttgtccaacagaaagtgtat
cctgacaacacttcagttatgtcgcattatgaaataaacgtagatgtgggtttacaaaaa
aacttgagtaacgatatgctgaaaccagtagagaaactggaaaacaatactgacagtaga
aaaaaacatgccggtactttcaagaaaacaaaatcagatattactcgaaaaccaagtaaa
ccgacagctcaagacccagcagaagaggcgttacgggtgctgccctctacaagtgtaaag
agatcaggtgggcatcacaaagtcaaagctctagatgtgacagacaggcctagagatccc
catgctgtgggacagtttggacagcctgcaagagttcccaagaatgaagaactggaaagt
agaagacgctggagtgaaggattttttaatgtattcctgagtgaacagataccaatagat
agagccatcccagacaccagaccccaaacatgttcagaaagccttgttcatgatgacctg
cccagcaccagtgtgatcttctgctttgtggatgaggtttggtctactctgctgcgttcg
gtacacagtgtgctcaacaggtctcctccacagctcctgaaggagatcattctcgtggat
gactgcagcaccaaagactacctgaaggaacagttggatgtttatatgtctcaattccct
aaagtacgaatcatccatctgaaagagcgacaaggccttatcagagcaaggatggcaggg
gccgctgccgctacgggtgaagtgctgactttcctggactctcacattgagtgtaacgta
ggatggcttgagccactgttagaaagaatttacctggaccgcagaaaagtgccctgtcct
gttattgatgttatcaatgataaagacatgagttacatgcttgtggataacttccaaaga
ggcatttttaagtggccacttgtttttggctggagtgctctacctgaggaatatattcaa
aagaaccagatcaaagattcagatcccatcaggatagcatgttgttttatacacagccat
atattacataataatagaaagaagtcaggtaacgtgtttttgtttgtttttcagatctgg
atgtgtggtggtgagattgaaataatcccctgctctcgcgttggccacatcttccgcagc
gataacccttataagttcacgaaagaccgtgtaaagacagtggagagaaacttagccagg
gttgcagaggtgtggctggatgaatataaagaggtgttttacggtcatggctatcagcac
ctactggacaaaaatgtgactgatataggaaatctgacagaacagattcaattgagggaa
aaactcaagtgtaaaagctttaaatggtacttggaaaatgtctatccagatctggacacc
cctgtggtcaaagccgaaggactgattttcaatgttggaaccagaaaatgtttgatattt
caaaatgaaagcttctcattaactaaatgtgatctcacaaataagagtcaatattttacc
ttcacctggttaaggttgcttcgacagaacacttcctgtttggctcctcaggaaacacag
ctaaccatggaaccatgtgacaacactaagccacatctccgctggattcacaagtctggt
aaagctttgacggagcatttgatggcagaggtttattctcaacccatttgtctggaagca
ggaattaaagcagatggtgtcttccttaaaggctgtgatcgcttcagtacttttcagaaa
tggcagtttacacactactatgaatga

KEGG   Danio rerio (zebrafish): 100535692Help
Entry
100535692         CDS       T01004                                 

Gene name
galnt8b.2
Definition
(RefSeq) probable polypeptide N-acetylgalactosaminyltransferase 8 isoform X2
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100535692 (galnt8b.2)
   00514 Other types of O-glycan biosynthesis
    100535692 (galnt8b.2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100535692 (galnt8b.2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100535692 (galnt8b.2)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   100535692 (galnt8b.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100535692
NCBI-ProteinID: XP_003198272
ZFIN: ZDB-GENE-041210-84
Ensembl: ENSDARG00000095324
Vega: OTTDARG00000007593
UniProt: F1R913
LinkDB All DBs
Position
4
AA seq 595 aa AA seqDB search
MRISFAKSLFPVLSVAVVFLYLSSVKWEIKTQEEKLQRVQQNLSLHSSLLLHKLDKLEAH
LIAVEETRLNVKNEKKPAKKLFPDSYLFKRWSVELSEDEQRKAEDLFQKYGYNAFLSDRL
PLDRELPDTRDHRCAEREYPPDLPTVSVVLIYLDEALSVIQRAVYSIINRTPAHLLKEII
LVDDHSTNEDLQTQLHVYISSINEKHPGLVKMVTHAEQKGLSQARISGWKAASGDVVAIL
DAHIEVHVKWAEPLLARIQADRTLVLSPVFDKINYDDLEVTKYIASAHGFDWALWCMYVT
FPEKWYNQNDPSLPGKSPSVMGILVVDRLFFGEIGTLDEGMQVYGGENVELGIRVWLCGG
SIEVVPCSKIAHIERAHKPYMPDLSNVMKRNALRVAEVWMDEYKKNVYMAWGLPMQNHGI
DIGDLSERKKLRERLNCKRFKWYLENVYNLLNPMDDLLGYGSLINDLQTSLCLDKGPSEE
NTPILYPCHFLISQQFFYTTSGEILVGPLQPLLHSRNRCLADPGSGRFPEFSWCSDTEKP
KHMYWDFKQGQAIQNRDTKRCLEISTKQTGDYKNNVFIQQCRNQHWRIQHAIRDF
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaggataagctttgcaaagagtttgtttccagttttgtctgtcgctgtggtttttctc
tatttgagctctgtgaaatgggagataaaaacgcaagaggagaaacttcagcgagtccag
cagaacttgtcactgcacagctctcttctgctccacaagctggacaaactggaggctcat
ttgatcgctgtggaagagacacgcctcaatgtaaaaaatgagaagaaaccagcaaagaaa
ctattcccagattcatacctcttcaagagatggagtgtggagctttcagaggatgagcag
aggaaagctgaggatctctttcagaaatacggatataacgccttcctcagtgaccgactg
cctctggaccgagagctgccggacactcgagaccacagatgcgctgagcgtgaatatcct
cccgatctgcccaccgtcagtgtggtgctgatttatctggacgaggctctgtctgtcatt
cagagagccgtttacagcatcatcaacagaactccagctcatctgctgaaagagatcata
ctggtggacgaccacagcactaacgaggatctgcagacgcagctgcatgtttacatcagc
tccatcaatgagaagcacccaggcctggtgaagatggtgacccatgcagaacagaaaggc
ctctcgcaggccaggatctcaggctggaaggctgccagcggcgacgtggtcgccattctg
gacgcccacattgaggtccatgtcaaatgggcggagcctctacttgcacgcatccaggct
gatcgcacgctagtcttgagtcctgtgtttgataaaattaattatgacgatctggaggtg
actaaatacattgcctctgctcatggttttgactgggctctctggtgtatgtatgtgaca
ttcccggagaagtggtacaatcaaaacgacccttcgctgccaggaaagagtccctctgta
atgggaatactggtggtggatcgtctgttcttcggtgagatcgggactctggatgaaggg
atgcaggtgtacggaggagagaatgttgaattgggaatacgggtgtggctgtgtggaggg
agtatagaggttgtgccctgctccaaaatcgcacacattgaaagagcgcacaaaccctac
atgcccgacctgagtaacgtcatgaagagaaacgccctcagagtggccgaagtttggatg
gacgagtacaagaaaaatgtctacatggcttgggggcttcccatgcagaatcatgggata
gacattggtgacttatcagagagaaagaaactgagagagaggctgaactgcaaacggttt
aaatggtatctggaaaatgtctataatttgttaaaccccatggatgatttgcttggttat
ggatcgctgattaatgatctgcaaacaagtctatgtttggacaaagggccgtcagaggag
aacactcccattttatatccatgccattttttaatctcacagcaatttttctatacaaca
agtggagagatattagtcggtccccttcagccccttttacacagccgaaaccgctgtcta
gctgatccaggatcgggccggtttccagagttttcctggtgttcagacacagagaaacca
aaacacatgtactgggacttcaaacagggacaggccatacagaacagagacaccaagcgc
tgtctggagatcagcaccaaacagacaggagactataaaaataacgttttcattcagcag
tgcagaaaccaacactggaggatacaacatgcaattcgggacttttaa

KEGG   Danio rerio (zebrafish): 103910015Help
Entry
103910015         CDS       T01004                                 

Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 10-like
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103910015
   00514 Other types of O-glycan biosynthesis
    103910015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    103910015
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103910015
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   103910015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 103910015
NCBI-ProteinID: XP_009296677
Ensembl: ENSDARG00000100453
LinkDB All DBs
Position
Unknown
AA seq 595 aa AA seqDB search
MRRRQKRLLRVGLLLSAALLLLLLGSVSLERRLDAEEPEGGAGLAQMQKVNRKQVLKDGV
RKKDWHDYAAIRSDAARTGAGEQGRPYPLTDAERVDQAYRENGFNIFVSDRIALNRSLPD
IRHPNCKLKLYTADLPNTSVIIPFHNEGWSSLLRTVHSVLDRSPPSLIAEIILVDDFSDK
GHLKAPLEQYMVRLPKVRILRTQKREGLIRTRLLGAAAARGQVITFLDSHCEANVNWLPP
LLDRIAQNRKTIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAQLAKPDPS
EPFDSPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVG
HIYRKYVPYKVPGGVSLARNLKRVAEVWMDEYAEFLYQRRPEYRHLSSGDVSQQKELRSR
LHCRSFRWFMEEVAWDLPKHYPPVEPPAAAWGELRNVGTGLCVESKHFSSGSPIRLEPCL
RSRGEPSWSHGQVFTFGWRQDIRVGDPLHTKKVCFDAVSHNSPVTLYDCHGMKGNQLWAY
RKDRSLFHPISNSCVSADAAQKRLLMSSCDASSSSQQWVFQNTNSSVLDSFNQRT
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcaggcagaagcggctgctgcgggtcgggctgctgctctccgcggcgctgctg
ctgctgctgctgggctccgtcagtctggagcgccggctggacgcggaggagccggagggc
ggagcgggactcgcgcagatgcagaaagtgaacagaaagcaagtgctgaaggatggcgtc
cggaagaaggactggcatgactatgcagccatcaggagtgacgcggcacgaacaggtgct
ggagagcagggccggccgtacccactgacggatgcagagcgtgtggatcaggcctacaga
gagaacggcttcaacatcttcgtcagcgaccgcatcgccctcaacagatcactgcctgac
atcagacaccccaactgtaagttgaagctgtacactgcagatctccccaacaccagcgtc
atcatcccgttccacaatgagggctggtcgtctctgctgcggacggtgcacagtgtgctg
gatcgctcgccgccgtcgctcatcgcagagatcatcctggtggacgacttcagtgataaa
gggcacctgaaggctccgctggagcagtatatggtgcgtctcccgaaggtgcggatcctg
cgcactcagaagcgtgagggtctgatccgcaccaggctgctgggggccgccgccgcccgc
gggcaggtcatcaccttcctggactcacactgcgaggccaacgtcaactggctgccgccg
ctgctggatcgaatcgcacagaaccggaagaccatcgtgtgtccgatgatagacgtgatc
gaccacgataacttcggctatgagacgcaggcgggcgacgccatgcgcggggcgttcgac
tgggagatgtactataaacgcatccccatccctgcacagctggccaaacctgaccccagc
gagcccttcgactctccagtgatggccggtgggcttttcgctgtggacaggaagtggttc
tgggagttgggaggatatgacacgggtctggagatctggggtggagagcagtacgagatc
tccttcaaggtgtggatgtgcggcggccgtatggaggacatcccctgctctcgggtcggt
cacatctaccgtaaatatgtgccgtataaagtgccgggcggagtgagcctcgccaggaac
ctgaagcgtgtggcggaggtgtggatggacgagtatgcagagttcctgtaccagcggcgt
ccggagtaccggcacctgtcgtcaggtgatgtgtcccagcagaaggagctgcgcagccgg
ctgcactgcaggagcttccgctggttcatggaggaggtggcctgggacctgcccaaacac
tacccgcccgtggagcctccggcagccgcatggggagagctgcgtaacgtgggcactggg
ctgtgtgtggagagcaaacacttctcctccgggtccccgatccgcctggaaccatgcctg
aggagccgcggagagcccagctggagccacgggcaggtgttcaccttcggctggcggcag
gacatccgcgtgggagaccctctgcacactaagaaggtctgtttcgacgcggtatcgcac
aacagccccgtcacactgtacgactgccacggcatgaagggcaaccagctgtgggcatac
aggaaggaccgcagtctcttccacccgatcagcaacagttgtgtatcagcagacgcagca
cagaagcggctcctcatgagctcctgcgacgcctcgtcctccagccagcagtgggtcttc
cagaacaccaacagcagcgtgctggactccttcaaccagcgcacataa

KEGG   Danio rerio (zebrafish): 406477Help
Entry
406477            CDS       T01004                                 

Gene name
galnt6
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 6
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    406477 (galnt6)
   00514 Other types of O-glycan biosynthesis
    406477 (galnt6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    406477 (galnt6)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     406477 (galnt6)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   406477 (galnt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 406477
NCBI-ProteinID: NP_998361
ZFIN: ZDB-GENE-040426-2272
Ensembl: ENSDARG00000014386
Vega: OTTDARG00000028613
UniProt: Q6NX01
LinkDB All DBs
Position
23
AA seq 619 aa AA seqDB search
MRLRRRLSPLKLAIVGGTLFMLILVVLQRDVNSGALQDPWLQDLSNKKERVFEMVRGAVN
NFAFQIGAPVRPSVEVQPTPDRNCPSGFYTQRELKPWIERPPENPQAPGADGVPFQYDRM
TKEEEKEKQEGMTRHCFNQFASDRISLHRTLGDDTRPPECVDRKFRRCPALPTTSVIIVF
HNEAWSTLLRTVYSVLHTSPAAFLKEIIMVDDASTAEHLHGKLEEYVKALKIVKVVRQPE
RKGLITARLLGASKAEGEILTFLDAHCECFHGWLEPLLARIVEEPTAVVSPEITTIDLNT
FQFHKPVATARAHNRGNFDWSLTFGWEGIPDYENAKRKDETYPVKTPTFAGGLFSISKAY
FEKIGTYDDKMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTEVIT
RNQVRLAEVWMDDYKLIFYRRSQSAAKMAKEKGFGDISDRLKLREDLQCKNFSWYLSNVY
PEAFVPDLSPVKFGALKNRGAQQCLDVGESNNGGKPVIMYTCHNMGGNQYFEYTSHKELR
HNIGKQLCLQASPYPEPVKIELCTLKGKGSSLAPEQEWLITEEQLLKNPSSGKCLHKKGD
KILMSPCNPDDHHQQWAFS
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaaggcgtcgtctttcgcccctgaagcttgccattgtcggtgggacacttttt
atgctcattctagtggtgctccagagagacgttaacagcggtgctcttcaggacccctgg
ctgcaagatctctccaacaaaaaggagagggtgttcgagatggtccgcggggctgtcaat
aactttgccttccaaataggagcccctgtgcgtccatcagtggaagtacaacccaccccg
gaccgaaactgcccatctggcttctacactcagcgggagcttaaaccatggattgagagg
cctcctgaaaaccctcaagccccaggagccgatggtgtacctttccagtatgaccggatg
accaaagaggaggagaaggagaagcaggagggcatgaccagacactgctttaaccaattc
gccagtgaccgaatctccttgcaccgcactcttggagatgacacccgtccgcctgagtgt
gtcgatcgcaagtttcgtcgatgtcctgctcttcccaccaccagcgtgatcatcgtgttt
cataatgaagcatggtcaacactactgcgcactgtgtacagcgttctgcacacctcccca
gcggcctttctcaaagaaatcataatggtggatgacgccagcactgcagaacaccttcat
ggaaagctggaggagtatgtgaaagcactgaagatcgtgaaggtggtgcgtcagcccgag
aggaaaggcctgatcacagcgaggcttcttggagcaagtaaagctgaaggagaaattctc
acgttcttggacgctcactgtgagtgtttccatggctggctcgagcctcttcttgctcga
attgtcgaagagcccacggccgttgtgagccctgagatcacaaccatcgatttaaacact
ttccagttccacaaacctgtggcgacggctcgtgcacataacaggggcaactttgactgg
agtcttacttttggctgggagggaattccagattatgagaacgctaaacgcaaggatgag
acctaccctgtaaaaactccaacatttgctggtggcttgttctctatatctaaggcctac
tttgagaaaattgggacgtatgatgacaaaatggagatctggggtggtgaaaatgtcgag
atgtctttcagggtatggcagtgtggtggacagttggaaataatcccctgctctgtcgtt
ggtcatgtgtttcgcaccaagagtcctcacaccttccccaaaggtacagaggtcattaca
cgtaaccaggtgcgcttggcggaggtgtggatggacgactacaagctgattttctacaga
cgcagccaaagcgcagctaaaatggccaaagaaaaaggctttggggatatttctgaccgt
ctgaaactccgagaagatttacagtgcaagaacttttcctggtacctatccaatgtctac
ccagaagcctttgtccccgatctctcgccagtcaagtttggagctctcaagaatagagga
gcacaacaatgtctggatgtcggagaaagtaacaatgggggaaagcctgtgattatgtat
acttgtcacaacatgggtggtaatcagtattttgaatacacgtcacataaggagctaagg
cataacataggaaagcagctgtgtctgcaagcgtctccttacccagagccggtgaagatc
gagctttgtacactgaagggcaaaggcagtagtttggctcctgaacaagaatggctgatc
acagaggagcaactcttgaaaaatccgtcctctggaaaatgcctccataagaagggagac
aagatcttaatgagtccctgcaacccagacgaccatcatcagcagtgggctttcagctga

KEGG   Danio rerio (zebrafish): 503760Help
Entry
503760            CDS       T01004                                 

Gene name
poc1bl
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 4 precursor
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    503760 (poc1bl)
   00514 Other types of O-glycan biosynthesis
    503760 (poc1bl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    503760 (poc1bl)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     503760 (poc1bl)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   503760 (poc1bl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 503760
NCBI-ProteinID: NP_001038243
ZFIN: ZDB-GENE-050306-41
Ensembl: ENSDARG00000012745
Vega: OTTDARG00000015627
UniProt: Q5CZV4
LinkDB All DBs
Position
19
AA seq 582 aa AA seqDB search
MKIRWSRKVAVLAKVCFLFSLLWLFCLLIVRSSPPSLADNDGRRDILARDLPPIEEEEED
SENLLRPVYEKLPPDSNAPGEYGRATRLTLTSEEKKEEEASVERCAINIFISDKISLHRH
IQDNRMHECKAKKYNIRRLPTTSVVIAFYNEAWSTLLRTIHSVLETTPAVLLKDIILVDD
FSDRGYLKSQLAQYISNLERVRLIRTKKREGLVRARLIGATYATGSVLTFLDCHCECVPG
WIEPLLERIAENETTIICPVIDTIDWNTFEFYMQTEEPMVGGFDWRLTFQWHAVPEIDRK
IRKSRIDPIRSPTMAGGLFAVSKAYFEYLGTYDMGMEVWGGENLELSFRVWQCGGSLEIH
PCSHVGHVFPKKAPYARSNFLQNTVRAAEVWMDTYKQHFYNRNPPARKESYGDISERIVL
RNRLQCKSFEWYLQNVYPGLHVPEDRPGWHGAVRSAGIHSECLDYNAPDHNPTGAHLSLF
GCHGQGGNQYFEYTSQREIRFNSVTELCAEVQDGMTHIGMKHCPQDGVPKPPSIIWQFRE
DGSIFHPHSNMCITSYRTEEGRADIQMRSCSTGDKHQRWSFE
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccgctggtcaaggaaggtggctgtcctggccaaggtctgcttcctcttttct
ctactatggctcttctgcctcctcatagtgcgttcttcacctccatctctggctgataac
gatggtcggcgtgacatcctggcccgtgaccttccacccattgaggaggaagaggaggac
tctgaaaaccttctgcggcctgtttatgaaaagctaccgccagactccaacgctcctgga
gaatacggacgagccactcgactgaccctcacttctgaggaaaagaaagaggaggaggct
agcgttgagcgctgcgccatcaatatcttcatcagcgacaagatatctcttcatcgccat
attcaagacaacaggatgcatgaatgcaaagcaaagaagtacaacatccgtcgtctcccg
acaacatcagtggttatagcattttacaatgaggcctggtctactttactgagaaccatc
cacagtgtgctggagaccacaccggccgtcctgctgaaggacatcattctagttgacgac
ttcagcgatagaggttatctgaagtcacagctggcacagtatatcagtaacctggagcgt
gtgcgtctcattcggacaaaaaaaagagaaggtctggttagggcacggctcattggcgcc
acctacgctacaggaagcgtgctcaccttcctggactgccactgcgagtgtgtgccaggc
tggatcgagccactgctggaaagaattgcagagaatgagaccaccataatttgtccagta
atcgacactattgactggaacacatttgagttctacatgcagacagaagagccgatggtg
ggcggttttgactggaggttgacatttcagtggcatgcagtgcctgaaattgatcgcaag
atacgcaaatccagaattgaccccattaggtctcccactatggcaggaggcctgtttgcc
gtcagcaaggcctactttgagtatcttggcacttatgacatgggcatggaggtctgggga
ggagagaatctggaactttctttccgggtatggcagtgcggagggtctttagaaatccac
ccatgctcccatgtgggtcatgtgtttcccaaaaaagcaccttatgctcgatcaaacttc
cttcaaaacacagtccgagctgcagaagtatggatggacacatacaagcagcacttctac
aacagaaaccctccagcacgcaaggaatcgtatggggatatatcagaaaggattgtccta
cgaaatcggcttcagtgtaagagctttgagtggtacctgcagaacgtttacccaggactg
catgtgccagaggacaggcctggctggcacggagcggttcgaagtgctggaatccactct
gaatgtctggattacaacgccccagaccacaaccccacaggagctcacctgtccctgttt
ggatgccatggtcagggcggtaatcagtactttgagtacacatctcaaagggagattcgc
tttaactccgtgaccgagctgtgcgctgaagttcaagatggaatgacacacatcggcatg
aagcattgtccgcaagacggcgttcccaaacctcccagcatcatatggcagttcagagaa
gacggcagcatatttcaccctcattcaaacatgtgtatcacctcatatcgcactgaagag
ggccgtgcagatatccaaatgagaagctgctctactggagacaaacaccagcgatggagc
ttcgagtga

KEGG   Danio rerio (zebrafish): 553668Help
Entry
553668            CDS       T01004                                 

Gene name
galnt7
Definition
(RefSeq) N-acetylgalactosaminyltransferase 7
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    553668 (galnt7)
   00514 Other types of O-glycan biosynthesis
    553668 (galnt7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    553668 (galnt7)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     553668 (galnt7)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   553668 (galnt7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_3 Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 553668
NCBI-ProteinID: NP_001018477
ZFIN: ZDB-GENE-050522-284
Ensembl: ENSDARG00000057303
Vega: OTTDARG00000029912
UniProt: Q502M4
LinkDB All DBs
Position
1
AA seq 652 aa AA seqDB search
MRLKVGFILRSLLVISTFLGLVLLWSSLTPKAGDDNPFAGVMAREADKLPQPNLPNNNVA
DQFKPVVPWPHVEGVEVDLESIRQKNVDNPNPAFKAQNQQNVIQKQYITFKPHTNMYSDP
VLNKGTLGNFEPKEPEPHGVQGGPGEGSKPFVLGPEYKDAVQASIKEFGFNMVASDMISL
DRTVGDLRHEECKYWNYDENLLTSSVIIVFHNEGWSTLMRTVHSVIKRTPRKYLAEIVMI
DDFSNKAHLKERLEEYIKQWNGLVKVFRNEKREGLIQARSIGARKATLGKVLIYLDAHCE
VGVNWYAPLVAPISKDRTVCTVPLIDYIDGNDYTIEPQQGGDEDGLARGAWDWSLLWKRV
PLSSREKAKRKHKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEISYKIWQ
CGGQLLFVPCSRVGHIYRLQGWQGNPPPAHVGSSPTLKNYVRVVEVWWDDYKDYFYASRP
ETLTLAYGDISTLKKFREEHRCKSFKWFMEEIAYDIPLHYPLPPKNVEWGEIRGYETSYC
IDSMGHTNGGNVEIGPCHRMGGNQLFRINEANQLMQYDQCLTKGGDGSAVIITHCNLNEH
TEWKYFKDLHRFTHVPTGKCLDRSDVLHKVYIADCDNSKSSQKWEMNNIVAV
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaggttaaaggttggattcatccttcgaagtttgctggtcatcagcacatttttgggg
ctggttttgctttggtcttctttgacaccgaaggctggagacgataacccgtttgctggt
gtaatggcaagagaggctgataaactcccgcagcccaaccttcccaataacaacgttgca
gaccagtttaagccagttgttccttggccccatgtcgaaggagttgaggtcgatctagag
tccatccgccagaagaatgtggacaacccaaacccagcattcaaagcccaaaaccagcag
aatgtcatccagaagcaatatatcacttttaaaccccacaccaatatgtacagtgatcct
gttttgaacaaagggactctgggcaactttgagccgaaagaacctgagcctcatggggtc
cagggcggaccgggagagggcagtaaaccgttcgttctgggaccagagtacaaagatgcg
gttcaagccagcatcaaggaatttggctttaatatggtagccagtgacatgatctctctg
gatcgaactgttggtgacttgcgtcatgaagagtgtaaatactggaactatgatgaaaac
ctcctcacctccagtgtgatcatagtctttcataatgagggctggtccaccctgatgagg
acggtgcacagtgtcatcaaaagaaccccaaggaaatacctggctgagatcgtcatgatt
gatgacttcagtaacaaagctcaccttaaagagcggctggaggagtacataaaacaatgg
aacgggttggtcaaagtgttccgcaatgagaagagagagggtctgatccaggccaggagc
ataggagcccgcaaagccactttaggaaaggtgctgatctacctggatgcacattgtgag
gtcggagtgaactggtatgccccgctggtggcccccatttcaaaagacagaacggtctgc
acagtaccgttgatagattacatagacggcaatgattataccatagagccacaacagggt
ggggatgaggacggtctggcgcgaggcgcttgggactggagcctcctgtggaaaagggtt
cctctaagcagcagggagaaggctaagagaaagcataagaccgagccctatcggtctcct
gccatggctggagggctgtttgcaattgagagagaattcttctttgagttgggtctttat
gatccaggccttcagatctggggaggtgaaaactttgagatctcatacaagatatggcag
tgcggtgggcagcttctgttcgtgccatgttcacgggtggggcacatctaccgtctgcag
ggctggcagggaaacccacctcctgctcatgtcggctcatccccaacacttaagaactat
gtgcgggtggtggaggtatggtgggatgattacaaggactatttctacgctagtcgaccg
gagacactcactctggcctacggggacatcagcaccttgaaaaagttcagagaggagcat
cggtgcaagagcttcaagtggttcatggaggagattgcctatgacatccctctgcattac
ccattgcctccaaaaaatgttgaatggggagagattcgtggatacgagaccagctactgc
attgacagcatgggccacactaatggtggcaatgtggagattgggccttgtcatagaatg
ggtggcaatcagctcttcagaattaatgaagctaaccagctgatgcagtacgaccagtgc
ctgacaaaggggggagatggatctgctgtcatcataacacactgtaacttgaacgagcac
acagagtggaaatattttaaggatctacaccgattcacacatgtacctacaggaaaatgc
ttggatcgctctgacgtcctgcacaaggtctatatagcagactgtgacaacagtaagagc
tcgcagaagtgggagatgaacaacatcgtggcagtataa

KEGG   Danio rerio (zebrafish): 558716Help
Entry
558716            CDS       T01004                                 

Gene name
galnt11
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 11
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    558716 (galnt11)
   00514 Other types of O-glycan biosynthesis
    558716 (galnt11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    558716 (galnt11)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     558716 (galnt11)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   558716 (galnt11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 558716
NCBI-ProteinID: NP_001070030
ZFIN: ZDB-GENE-060929-998
Ensembl: ENSDARG00000063636
Vega: OTTDARG00000028682
UniProt: F1R7M5 Q08CC3
LinkDB All DBs
Position
24
AA seq 590 aa AA seqDB search
MGSVTLRYFCYGCLFTSVTWSILLFLYFNLSQESRLSFRNVPVQGQHRFQPRFTRGPAVQ
HRDGSQVRKGQALEAVKPDLSPELGMIFNKQDQEVRDMGYHKHAFNVLISNRLGYHRDVP
DTRTDKCRDRAYSVSLPTASIVICFFNEAFSALLRTVHSVLDRTPNYLLHEIILVDDHSE
LDDLKEDLDSYVQQHLQKKVKVVRNEKREGLIRGRMIGASHATGEVLVFLDSHCEVNEAW
LQPLLTPIKENRKTVVCPVIDIISADTLVYTPSPIVRGGFNWGLHFKWDPVPMSELNSPD
GAIRSPTMAGGLFAMDRNYFYELGQYDRGMDIWGGENLEISFRIWMCGGQLLIVPCSRVG
HIFRKRRPYGSPGGQDTMAHNSLRLAHVWMDDYKEQYFALRPELRNRDYGDISERVSIRK
RLQCHSFKWYLDNIYPEMQVSSPHKPQQPVFINKGLKRPKVLQRGRLRNLLADKCLVAQG
RPSQKGGAVVVKDCDPQDPEQEWAYDEEHELVLAGLLCLDMSEIRSSDPPRLMKCHGSGG
SQQWTLGKKNWLYQVSVGQCLAVGDPLSIKGYVSMAICDDSRSQQWQLEG
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgtcactctgcgctacttttgttatggttgcctcttcacctccgtgacctgg
tcgattcttctgttcctctatttcaacctcagccaggaaagccgactatccttcagaaat
gtgcccgtccaggggcagcaccgttttcagcctcgttttacgcgtggccctgcagtccag
catagagatgggagtcaagtgcgtaaaggccaagcactggaagccgtcaagccagatctc
tctccagagctgggaatgatttttaacaagcaggaccaagaggtacgagatatgggctat
cataagcacgccttcaatgtactcatcagtaaccggctcggctaccacagagacgtccca
gacaccaggactgacaagtgcagggacagggcttattcagtgtccttgcccacagccagt
atagtgatctgtttcttcaatgaggcgttctctgccctcctgaggaccgttcacagtgtg
ctggatcgcacaccaaactacctgctccatgagatcatactggtggatgaccacagtgaa
ctggatgatctgaaggaagacttggattcttacgttcagcagcacctgcagaagaaagta
aaggtggttcgtaatgagaagagggaggggctgatccgcgggaggatgattggtgcatct
catgctacaggtgaggtgttggtgtttctggacagtcactgtgaggtgaatgaggcctgg
ctccagcctctgctcacccctattaaagagaacaggaaaactgtggtgtgcccagtcatc
gacatcatcagcgcagacacactagtatacaccccttctcctatcgttcgaggaggattc
aactggggcttgcactttaagtgggacccagtgcccatgtccgaactcaacagccctgat
ggagccattaggtctcctacgatggcaggtggactcttcgccatggacagaaattacttt
tatgagcttggtcagtacgaccgtggcatggatatatggggtggagagaacttggaaata
tcttttcggatttggatgtgtggaggccagttactgatcgttccctgctccagggtgggg
cacatcttccgcaagcgccggccgtatgggtcacctggaggtcaggatacaatggctcat
aattccctgcgtttggcccatgtctggatggatgactataaggagcagtactttgccttg
cggcctgagctgaggaaccgggactatggggacatcagtgagcgggtctctattcgcaag
cggctgcagtgtcactccttcaaatggtacctggacaatatataccccgaaatgcaggtg
tcctctccgcacaagccccagcagcctgtcttcatcaacaagggtttaaagagaccaaaa
gtactgcagcggggtcggttgcgtaatctcttggctgacaagtgtctggtggcacagggc
cgtcccagtcagaaggggggcgctgtggtggtgaaagactgtgacccacaggaccctgag
caggaatgggcatatgatgaggaacatgagttggttctagccgggctgctgtgtttggac
atgtcagagattcgttcctccgacccgccgcgcctcatgaagtgtcacggctctggtgga
tctcagcagtggacactggggaaaaagaactggctgtaccaggtgtcagtggggcagtgt
ttggctgtgggcgaccctctcagcatcaaagggtatgtttccatggcgatctgtgatgat
tcccgctctcagcaatggcagttggagggttga

KEGG   Danio rerio (zebrafish): 559073Help
Entry
559073            CDS       T01004                                 

Gene name
galnt1
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    559073 (galnt1)
   00514 Other types of O-glycan biosynthesis
    559073 (galnt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    559073 (galnt1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     559073 (galnt1)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   559073 (galnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 559073
NCBI-ProteinID: XP_009290644
ZFIN: ZDB-GENE-030131-2360
Ensembl: ENSDARG00000061335
Vega: OTTDARG00000033321
UniProt: E7FDA0
LinkDB All DBs
Position
16
AA seq 557 aa AA seqDB search
MRKFAYCKVVLATSLVWVMLDMFILLYFSECNKCDDKKERGLPGRDTVVQRPHDGPGEMG
KPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVI
VFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVR
MEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVIS
DDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDY
FQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQII
NKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDS
QIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLC
LDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSG
ARSQQWLLRNVTLPEIF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagtttgcgtactgtaaggtggtgctggccacctctctggtgtgggtgatgcta
gacatgttcatcctcctctacttcagcgaatgcaacaagtgtgacgataaaaaggagaga
ggattgccggggagagacaccgtggttcagaggcctcatgatggccccggggagatgggc
aaaccagtggtcatcgctaaagaccagcaggagaagatgaaggaaatgtttaagataaac
cagtttaacctgatggccagcgagatgattgcgctcaaccgatcattaccggacgtccgg
ctcgagggatgtaaaacgaaagtgtatccagatgatctgccgcgcaccagtgtggtgatc
gtgtttcataatgaagcatggaccacactgctccggacggtgcacagcgtcatcgacagg
tcacctagacacctgctggaggagattgtcctggtggatgacgccagcgagagagacttc
ctaaagcggcagctggagcattatgtgcggaagttggaggttcctgtgagggtggtgaga
atggagcagcgctcaggcctgattcgcgctcggttgaagggggcatcaatctccacaggt
caggtgatcacctttctggatgcccactgtgagtgcaccaccggctggctcgagcctctg
ctctctcgcatcaaacttgacaagaaaaccgtagtgtgtcccatcattgacgtgatcagc
gatgacacgtttgagtacatggcaggctctgatatgacatatggtgggttcaactggaag
ctgaacttccgctggtatcctgtcccacagagagagatggaccgcaggaaaggagaccga
acgctgcctgtcaggaccccgacaatggcaggtggcctcttctccatagacagagattat
ttccaggagatcggcacatatgatgcaggaatggacatctggggaggagaaaacctggag
atctcatttaggatttggcagtgtggcgggacgcttgagattgtcacatgttctcacgtc
ggtcacgtgtttcgtaaagcaacgccttacacgttccctggtggaactgggcaaatcatc
aacaagaacaacagacggctggcagaggtctggatggacgagttcaagaacttcttctac
atcatctcacctggtgtgacgaaagtggattatggagacatctcaaccagaacatccctg
agacagagactgcaatgcaagcccttctcctggtacctggaaaatgtctacccagactca
cagataccacgccactactactcactgggagagatccgtaatgtggagactaaccagtgt
ctggataacatggccagaaaagagaatgagaaagtgggcattttcaactgccatggcatg
ggcggtaaccaggttttctcatacacagccaataaagagatccgaactgatgatctctgt
ttggatgtttccaaactcaatggcccggttatgatgctcaagtgccatcatttgaaaggc
aaccagctctgggaatatgaccctgtgaagctgagtctggtacacgtgaacagtaatcag
tgtttggataaggcatctgaagatgacagtcaggtgcccagcgtcagggactgcagcggg
gcccgttcacagcagtggcttctccgcaacgtcacactgcccgaaatattctga

KEGG   Danio rerio (zebrafish): 559373Help
Entry
559373            CDS       T01004                                 

Gene name
galnt8b.1
Definition
(RefSeq) probable polypeptide N-acetylgalactosaminyltransferase 8 isoform X2
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    559373 (galnt8b.1)
   00514 Other types of O-glycan biosynthesis
    559373 (galnt8b.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    559373 (galnt8b.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     559373 (galnt8b.1)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   559373 (galnt8b.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 559373
NCBI-ProteinID: XP_003198271
ZFIN: ZDB-GENE-041210-83
Ensembl: ENSDARG00000045851
Vega: OTTDARG00000007592
UniProt: F1R0I8
LinkDB All DBs
Position
4
AA seq 595 aa AA seqDB search
MRISFVKSLFPVLSVAVVFLYLSSVKWEIKTQEEKLQRVQQNLSLHSSLLLHKLDKLEAH
LIAVEESRLKVKSEKKPAKKLFPDSDLFKRWSVELSEDEQRKAEDLFQKYGYNAFLSDRL
PLDRELPDTRDHRCAEREYPPDLPTVSVVLIYLDEALSVIQRAVYSIINRTPAHLLKEII
LVDDHSTNEDLQTQLHVYISSINEKHPGLVKMVTHAEQKGLSQARISGWKAASGDVVAIL
DAHIEVHVKWAEPLLARIQADRTLVLSPVFDKINYDDLEVTKYFASAHGFDWALWCMYVT
FPKKWYNRNDPSLPGKSPSVMGILVVDRLFFGEIGTLDEGMQVYGGENVELGIRVWLCGG
SIEVVPCSKIAHIERAHKPYMPDLSNVMKRNALRVAEVWMDEYKKNVYMAWGLPLENHGI
DIGDLSERKKLRERLNCKPFKWYLENVYTELNPMDDLLGYGALINDLQTSLCLDKGPSEE
NTPILYPCHFLTSQVFFYTTSGEILVGPLQPLLHSRNRCLADPGSGRFPEFSWCSDTEKP
KHMYWDFKQGQAIQNRDTKRCLEISPKQTGDYKNNVFVQECRNQHWRIQHVIKDL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaggataagctttgtgaagagtttgtttccagttttgtctgtcgctgtggtttttctc
tatttgagctctgtgaaatgggagataaaaacgcaagaggagaaacttcagcgagtccag
cagaacttgtcattgcacagctctcttctgctccacaagctggacaaactggaggctcat
ttgattgctgtggaagaaagtcgccttaaggtaaaaagtgagaagaaaccagcaaagaag
ctattcccagactcggacctcttcaagagatggagtgtggagctttcagaggatgagcag
aggaaagctgaggatctctttcagaaatatggatataacgctttcctcagtgaccgactg
cctctggaccgagagctgccggacactcgagaccacagatgcgctgagcgtgaatatcct
cccgatctgcccaccgtcagtgtggtgctgatttatctggacgaggctctgtctgtcatt
cagagagccgtttacagcatcatcaacagaactccagctcatctgctgaaagagatcata
ctggtggacgaccacagcactaacgaggatctgcagacgcagctgcatgtttacatcagc
tccatcaatgagaagcacccaggcctggtgaagatggtgacgcatgcagaacagaaaggc
ctctcgcaggccaggatctcaggctggaaggctgccagcggcgacgtggtcgccattctg
gacgcccacattgaggtccatgtcaaatgggcggagcctctacttgcacgcatccaggct
gatcgcacgctagtcttgagtcctgtgtttgataaaattaattatgatgatctggaggtg
actaagtatttcgcctctgctcatggttttgactgggctctctggtgtatgtatgtgaca
ttcccgaagaagtggtacaatcgaaacgacccttcgctgccaggaaagagtccgtctgta
atgggaatactggtggtggatcgtctgttcttcggtgagatcgggactctggatgaaggg
atgcaggtgtacggaggagagaatgttgaattgggaatacgggtgtggctgtgtggaggg
agtatagaggttgtgccctgctccaaaatcgcacacattgaaagagcgcacaaaccctac
atgcccgacctgagtaacgtcatgaagagaaacgccctcagagtggccgaagtttggatg
gacgagtacaagaaaaatgtctacatggcttgggggcttcccttagagaatcatgggata
gacattggtgacttatcagagagaaagaaactgagagagaggctgaactgcaaaccgttc
aaatggtatctggaaaatgtctatactgagttaaatcctatggatgatttgcttggttat
ggagcgctgattaatgatctgcaaacaagtctatgtttggacaaagggccgtcagaggag
aacactcccattttatatccatgccattttttaacctcacaggtgtttttctatacaaca
agtggagagatattagtcggtccccttcagccacttttacacagccgaaaccgctgtcta
gctgatccaggatcgggccggtttccagagttttcctggtgttcagacacagagaaacca
aaacacatgtactgggacttcaaacagggacaggccatacagaacagagacaccaagcgc
tgtctggagatcagccccaaacagacaggagactataaaaataacgttttcgttcaggag
tgcagaaaccaacactggaggatacaacatgtaattaaggacttatga

KEGG   Danio rerio (zebrafish): 559736Help
Entry
559736            CDS       T01004                                 

Gene name
galnt12
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 12
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    559736 (galnt12)
   00514 Other types of O-glycan biosynthesis
    559736 (galnt12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    559736 (galnt12)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     559736 (galnt12)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   559736 (galnt12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 559736
NCBI-ProteinID: XP_688194
ZFIN: ZDB-GENE-060503-704
Ensembl: ENSDARG00000055490
Vega: OTTDARG00000015623
LinkDB All DBs
Position
19
AA seq 578 aa AA seqDB search
MAICGRRSRSKFILYIVGAFVVGYLVFHRNTQSDVGLAKIREVPDEHKNVDEQFLKRPVY
EKPALDVNALGEMGRAVKLDLSGEEKREEEESIKKHQINTYVSDRISLHRRLAERWNPLC
RNLKYDYLSLPTTSVVIAFYNEAWSTLLRTVHSVLETSPDLLLNEVILVDDYSDREHLKE
PLENYIADLKKVRLIRARKREGLVRARLLGASIATGEVLTFLDCHCECHEGWLEPLLQRI
KEEPSAVVCPVIDVIDWNTFQYLGNPGEPQIGGFDWRLVFTWHSIPEHEQKRRSAATDVV
RSPTMAGGLFAVNKKYFLYLGTYDTGMEVWGGENLEFSFRIWQCGGSLEIHPCSHVGHVF
PKKAPYSRNKALANSVRAAEVWMDDFKEVYYHRSPHARLEAYGDVTDRRKLRMRLRCKDF
RWFLDNIYPDIQVPEDKPGMFGMLKNKGMTNYCFDYNPPDEHKIAGHRVILYPCHGMGQN
QFFEYSTLQEIRYNTRDPAGCVVADPVSTFLTMNLCSKPREAVPEDQKFLFREDGSLYHV
QTQKCVEAVDRTDAGSPGPALRPCSDSDAQKWFFEERT
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcaatatgtggcagacggagtcgctccaagtttatcctgtacattgtcggtgctttt
gtagtgggctatttagtatttcacaggaacacgcagagtgatgtgggactggcgaaaata
agagaagtgccagacgagcacaaaaatgtggacgagcagtttctgaagagacctgtttac
gagaagcctgctttagatgtaaacgcgctgggagagatgggcagagctgttaaactggac
ctgagtggggaagagaagcgagaggaagaggagagcatcaaaaaacatcaaataaacact
tatgtgagcgataggatatctttacaccgcagactggctgaaagatggaaccctctttgt
agaaatctgaaatatgactacctgagcctgcctactacatcagtagtgatcgcattctac
aatgaagcctggtccacactattgaggaccgtgcacagtgtactggagacctcacctgac
ctgctgctgaatgaagtcattctggtggatgactacagtgaccgagaacacttaaaggag
cctctagagaattacatcgccgatctgaaaaaggttcgtctgatccgagcaaggaagaga
gaaggtctggtgcgagcgcggcttttgggggcttccatcgccacaggggaagtgctgacc
ttcctcgattgccactgcgagtgccatgaaggctggctggagcctttactccagagaata
aaggaggagccttcagctgtggtgtgtccagtcattgacgtcattgactggaacaccttc
cagtacctgggcaacccaggagaacctcagatcggaggatttgactggcgattggtgttc
acgtggcactctatcccagaacatgagcagaaacgcagaagtgccgccactgatgttgtc
aggtctccaacaatggctgggggtttgtttgccgtcaacaagaagtacttcctttacctg
ggcacatatgacacaggaatggaagtctggggtggagagaacctggagttttcatttaga
atctggcagtgtggaggaagcctggaaatccatccttgctctcacgtgggtcacgtcttt
ccgaagaaagctccatactcaagaaacaaggccttggccaacagtgtgcgagcagcagaa
gtctggatggatgatttcaaagaggtgtattaccaccgcagccctcatgcacgtctggaa
gcgtatggggatgtgacggatagacggaaactcagaatgcgtcttcgctgcaaagatttt
agatggttcttggataacatctaccctgatattcaagtccccgaagacaagcctggaatg
tttggcatgttgaagaacaaaggaatgaccaactactgcttcgactacaacccgcctgat
gaacataagatagccggtcaccgggtaatcctttacccatgtcatggcatgggacaaaac
cagttcttcgagtactccacactccaggaaatccgctacaacacgagggatcctgcaggc
tgtgtcgtagctgatcccgtctccacattcctcaccatgaatctttgtagtaaacccaga
gaagctgtgcccgaagaccagaagtttcttttcagagaggatggctctttatatcacgtt
cagacgcagaagtgtgttgaagcagtggatcggactgatgctgggagtcctggacctgct
cttcggccttgctcagactctgatgctcagaagtggttctttgaagagagaacatag

KEGG   Danio rerio (zebrafish): 562739Help
Entry
562739            CDS       T01004                                 

Gene name
galnt14
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 14
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    562739 (galnt14)
   00514 Other types of O-glycan biosynthesis
    562739 (galnt14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    562739 (galnt14)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     562739 (galnt14)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   562739 (galnt14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 562739
NCBI-ProteinID: NP_001038460
ZFIN: ZDB-GENE-041014-351
Ensembl: ENSDARG00000023448
Vega: OTTDARG00000006059
UniProt: Q5RFV2
LinkDB All DBs
Position
20
AA seq 554 aa AA seqDB search
MKRLSRKLTLALAALFWIAALLYFILLNSRKILPDQRNEQPQVKEISDTEWDDLLEEFEE
KSYLSAHRWKPGQDPYSLYAFNQRESERIPSNRALRDTRHYRCTTLHYDPDLPSTTIVIT
FHNEARSTLLRTVRSVLNRTPVHLIHEIILVDDFSEDPNDCLLLTKLPKVKCLRNKHREG
LIRSRVRGADAAGAQILTFLDSHCEVNKDWLPPLLQRVKEDPTSVASPVIDIINMDTFAY
VAASSDLRGGFDWSLHFKWEQLSAEKRAKRADPTEPIKTPIIAGGLFVIDRSWFNRLGKY
DTAMDIWGGENFEISFRVWMCGGSLEIIPCSRVGHVFRKKHPYIFPEGNANTYIKNTRRT
AEVWMDEFKLFYYSARPAARGKSYGDIHGRQELRKSLNCKSFKWYLDNVYPELKVPDDSD
AKSGVIRQRQNCLESRVVEGQDLPVLTLAPCIITKETPAANQEWIYTHGQQIRQQQYCLS
VSTTFPASQILLMPCNISDGKQRWQKSGTHLEHLASRFCVDSEMALDGIESSKMLVISPC
ELSAHTQRWEMPFS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggctttctcgaaagctgactttagctctggcagcgctcttttggatagcagct
ttactctatttcatactgctgaacagccggaaaatactacctgaccaaagaaacgagcaa
ccgcaagtcaaagagatctcagatactgagtgggatgacctgctggaagagtttgaagag
aaaagctacctcagtgctcacagatggaaaccgggccaggacccatacagtctgtatgcc
ttcaatcaaagagagagcgaacgaatccccagcaacagagcacttagagacacccgacat
tacaggtgtacaacactgcactatgaccctgatctgccatccaccaccatagtgatcacg
ttccacaatgaggcgcgatccaccctactgcgcacagttagaagtgtgttgaatcggacg
cctgtgcatcttattcatgaaatcatattggtggatgacttcagtgaagatccaaacgat
tgccttcttctcaccaagttgcccaaagttaagtgtcttcgcaataaacatagagaagga
ttgatccgctctcgtgttcgaggggctgacgctgcaggagcccagatcctgacttttttg
gacagtcactgtgaggtcaacaaagattggctgcctccactgctgcagagggtcaaagag
gacccgacctctgtcgccagccccgtgattgacatcattaatatggacacgtttgcctac
gtcgctgcttcctcagacttgcgaggaggattcgactggagtttacactttaaatgggag
caactatcagctgaaaagcgagccaagagagctgaccctacagagcccattaaaacgccc
atcatcgcaggaggacttttcgtgattgacagatcctggttcaatcgcttggggaaatat
gacaccgccatggacatctggggaggggagaatttcgaaatctcgttcagagtatggatg
tgtggaggaagcctggaaattatcccctgtagcagggtcggccacgttttccgcaagaaa
catccttacatcttcccagagggcaatgctaacacctacataaagaacaccagaaggacc
gctgaggtttggatggatgagttcaaactgttctactactcggctcgaccagctgccagg
ggaaaatcctatggagacattcacggcaggcaggagctccgcaagagtctcaactgcaaa
tccttcaagtggtatctggacaacgtctatccggagctcaaagtacctgatgattctgat
gccaagtctggtgtgatccggcagagacagaactgtctagagtctcgagtagtcgaaggc
caggatctcccagtgctcacactcgcaccctgcatcatcaccaaagagacaccagcagcc
aatcaggagtggatctacacccacggacagcaaatccgccagcagcagtactgtctgtcc
gtctccaccactttccctgcctcccagatcctactcatgccgtgcaacatcagcgacggc
aagcagcgctggcagaaatctggcactcacctggagcacctggcgtctcgtttctgtgtg
gacagtgagatggctctggatggcatcgagagcagtaaaatgctggtgatcagcccgtgc
gagctgtcggcacacacacagagatgggaaatgcctttctcgtga

KEGG   Danio rerio (zebrafish): 567794Help
Entry
567794            CDS       T01004                                 

Gene name
galnt17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    567794 (galnt17)
   00514 Other types of O-glycan biosynthesis
    567794 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    567794 (galnt17)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     567794 (galnt17)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   567794 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 567794
NCBI-ProteinID: XP_696189
ZFIN: ZDB-GENE-110419-5
Ensembl: ENSDARG00000042418
Vega: OTTDARG00000039834
UniProt: E7EZL6
LinkDB All DBs
Position
15
AA seq 617 aa AA seqDB search
MMRFTGFRTPKSFMAFVMRRWKILLVLNVFTVAGFITFWGKCNVRTTKGVGQQMAVDSRG
QTNLNGSVQETSITHDVLLKRLGSLEDVVYRQLNGLSKSLGLIEGFGGRGRGGIPATLTP
AEEKEAKFLREKYGYNAFLSDKISLDRSLPDYRPSKCKKAFFPRDLPQISIIFIFVNEAL
SVILRSVHSAVNHTPAHLLKEIILVDDNSDDVQLKGPLEEYVNKRYPGLIKIVRNQKREG
LIRARIEGWKVATGEVTGFFDAHVEFTPAWAEPVLSRIKENHKRIILPSIDNIKDETFEL
ERYENSGHGYNWELWCMYISPPKQWWDEGDTSAPIRTPAMIGCSFVVNREYFGDLGLLDA
GMDVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARTKKPYHSNIAFHTRRNALRVAEVW
MDQYKSNVYLAWNLPMKNHGIDYGDVSERLALRKRLQCKSFDWYLDNIYPEMRRYNNTVF
YGEIRNTNVTHLCVDQGIKENHTATLHPCHGWGPQLGRYTKEGYLFLGPLGSTGEDTRCV
VDDKISSYPQLLNCEKVSSVRQKTWHFAQNESIISRATGRCLEVVPANVYFGYALILRSC
TGQKWNIKNLMKQDQGQ
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttcactggattccgaacaccaaaatcgttcatggcctttgtgatgagaaga
tggaaaatattactggtgctgaatgtgtttacggtggccggctttatcactttttggggc
aagtgcaatgtacgcaccaccaaaggtgttggacaacagatggctgtcgattcaagagga
caaaccaatctgaatggatctgttcaggagaccagcatcactcatgatgtgctcttaaag
agactgggatcactggaagatgtggtgtacaggcaacttaatggtttgtccaaatctctt
ggactcatcgaaggttttggaggccggggtagaggaggtataccagccacacttacacca
gcggaagaaaaggaggccaaattcctgagggagaaatatggctataatgcatttctgagt
gacaaaatctctctggatagatcacttccagactaccgtcccagcaaatgcaaaaaggcc
ttttttccccgtgacctgccacagatttccatcatttttatcttcgttaatgaggcgttg
tctgttatactgcgttcagtccattcagctgtcaaccacacaccagcacatcttctaaag
gagatcatcttggtggatgacaacagtgatgatgtgcaactgaaaggcccactggaggag
tacgtcaacaaacgctacccgggtcttatcaaaatagtgcgcaatcagaagagagagggg
ctcatacgggctcgcatcgagggctggaaagtggccactggggaggtgaccggcttcttt
gatgcccatgttgaattcacgcctgcatgggctgaaccagttctgtctagaatcaaggag
aaccacaagaggatcatcttgccctccatagataacatcaaagatgagacgtttgaactg
gaacgctatgagaactcaggccacggctataactgggagctctggtgtatgtatatcagc
ccacccaaacagtggtgggatgaaggggacacttctgcacctatcaggacgcctgcaatg
ataggctgctcttttgtggtaaaccgggaatactttggggatttgggcctactggacgca
gggatggatgtgtatggaggcgaaaatatagagctgggaatcagggtttggttgtgtggg
ggcagcatggaagtcctgccttgttccagagtggctcatattgctcgaacaaagaagccc
taccacagtaacattgcctttcacacaagacgcaatgctcttcgagttgcggaagtgtgg
atggaccagtacaaatctaatgtctatttggcatggaacctaccgatgaagaaccatggc
attgactatggagatgtatcggagagacttgcactcaggaaaagactccagtgcaaaagc
tttgactggtacctcgacaatatctatccagaaatgagaagatacaacaacactgtcttt
tatggagaaattcgcaataccaatgtgacccatctgtgtgtggaccagggcataaaggaa
aaccacacagcaactctgcacccgtgccatggctggggccctcagctgggtcgctacact
aaggagggttatcttttcctgggtcctctgggaagcactggcgaagatactcggtgtgtg
gtggacgataaaatcagcagctatccacagctcctcaactgcgagaaagtctcaagcgta
cggcaaaaaacttggcactttgcacagaatgaatcaatcatcagccgagctacaggacgc
tgcctcgaggtagtgccggctaatgtctactttggctacgctctaatcctgcgctcatgt
actggccagaagtggaacatcaagaatctgatgaaacaagaccaagggcagtga

KEGG   Danio rerio (zebrafish): 568547Help
Entry
568547            CDS       T01004                                 

Gene name
galnt8a.1
Definition
(RefSeq) probable polypeptide N-acetylgalactosaminyltransferase 8
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    568547 (galnt8a.1)
   00514 Other types of O-glycan biosynthesis
    568547 (galnt8a.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    568547 (galnt8a.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     568547 (galnt8a.1)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   568547 (galnt8a.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 568547
NCBI-ProteinID: XP_021326338
ZFIN: ZDB-GENE-091015-4
Ensembl: ENSDARG00000012355
Vega: OTTDARG00000039339
LinkDB All DBs
Position
25
AA seq 597 aa AA seqDB search
MKIATRVGVLVIGCILYSLVYMFFIRPEQSKGNRLQRAEDLDVLQRLKRIEDQVHHLALE
VRSQKVKEAPVGQKITKKTEVKKLYPNSPLFSSWGAELTEEEQMEAEKLFQEFGYNVFLS
NRLPLNRTIPDTRDPRCALKIYPKDLPTISVILIYLNEALSVIKRAVHSIIDKTPAHLLK
EIVLVDDNSSNEDLQLPLNKYIDLINKAKPGLIKKVRHKRQMGLAKARMSGWEAATGQVV
AILDAHIEVHKEWAEPLLARIKANRTTVLSPVFDKVLFDTLEVINYNPAAHAFDWSLWCM
YESFRPEWYKLNDPSEPGKSPSVMGILVADRQFLGEIGALDDGMTIYGGENVELGIRVWL
CGGSVEVVPCSKIAHIERAHKPYSPDLSKPMIRNALRVAEIWMDEYKSNVNIAWNLPLKD
HGIDIGNVTERKQLREKLKCKPFKWYLENVYPQLDRWDGIMAYGTLKNDILENFCIDQGP
VPGSVPILYGCHYYEPQYCFYNQNGEIYIGGIKSHTYNSNRCLTDPGSGSTPALHNCKNA
QEKGMNIYWDFTQGNAIRNRKTNRCLEIGQGVDSYYTLILQTCTGQKWTIQHVIKNL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctacaagagttggcgtgttagttattggttgcatattgtatagtctcgtg
tacatgttttttatcagacctgaacagagtaaaggcaacaggttacaaagggcagaagat
ctggatgttcttcaaagactgaagagaatagaagatcaagttcatcatttagctctagag
gtcagaagtcaaaaagtcaaagaggctcctgtgggacagaaaattacaaagaaaactgag
gtgaagaagttgtatccgaattcaccgctcttcagttcatggggagctgaactgacagag
gaggaacagatggaagcagagaaactgtttcaggagtttggatacaatgttttcctcagt
aacagattacccttgaacagaacaatccctgatactcgagaccccagatgtgctctgaag
atctatcctaaggacttgccaaccattagtgtgattctgatttatctgaatgaggctctg
tcagtcattaaaagagccgttcacagcatcattgacaaaactcctgctcatctgctaaag
gagatcgtcctggtagacgacaacagctctaatgaggacctgcaattgcctttaaacaaa
tatattgatctaattaacaaagctaaacctggattaatcaagaaagtgcgacacaaaagg
cagatgggtctggccaaggcaagaatgtcaggttgggaagctgccacaggtcaagtggtc
gccattctggatgcccacattgaagttcataaggaatgggcagagccactacttgcacga
attaaagcaaacagaacaactgtattgtcaccagtgttcgacaaagtgctctttgacaca
ctggaggttattaactataatcctgctgctcatgcttttgactggagcctttggtgcatg
tacgagtcctttcggccagaatggtacaaactgaatgacccatcagaaccagggaagagt
ccctcagtcatgggtatccttgtcgctgatcgtcagttcctgggagaaattggagcactg
gatgatggaatgacaatttatggtggtgaaaatgtagaactgggaatacgtgtctggctc
tgtggtgggagtgttgaagtggtgccgtgttcaaagattgcgcacattgaaagagcacat
aagccttattcaccagatctcagcaaacccatgatccgaaacgcattgagagtggctgaa
atctggatggatgaatataaatccaatgtgaatattgcctggaatctgcctctgaaggat
catgggattgatattggtaatgtgactgaaagaaaacagttacgtgagaaactcaaatgt
aagcccttcaaatggtatctggaaaatgtctatcctcagcttgacagatgggatggcata
atggcttatggcacgttgaagaatgacattcttgaaaacttttgcattgatcaaggacct
gttcctggaagtgtgcctattctctacggatgtcattactatgagcctcagtattgtttt
tacaaccaaaatggagaaatctacattggtggcattaaatcccacacttataattctaac
cgttgtctaacggatcctggcagtggaagcacaccggctttacataactgtaaaaatgca
caggagaaaggaatgaacatttactgggacttcactcagggaaatgcaataagaaataga
aaaacaaaccgatgtcttgagatcggccaaggagtggattcatactataccctcattctg
caaacatgcacaggacaaaaatggacaattcagcatgtcatcaaaaacctttaa

KEGG   Danio rerio (zebrafish): 568915Help
Entry
568915            CDS       T01004                                 

Gene name
si:ch211-15e22.3
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase-like 6
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    568915 (si:ch211-15e22.3)
   00514 Other types of O-glycan biosynthesis
    568915 (si:ch211-15e22.3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    568915 (si:ch211-15e22.3)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     568915 (si:ch211-15e22.3)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   568915 (si:ch211-15e22.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_2 Fer4_NifH
Motif
Other DBs
NCBI-GeneID: 568915
NCBI-ProteinID: NP_001139074
ZFIN: ZDB-GENE-090312-115
Ensembl: ENSDARG00000040048
Vega: OTTDARG00000029910
UniProt: B8A6C4
LinkDB All DBs
Position
1
AA seq 600 aa AA seqDB search
MKRRQKRVLQMAFLFMVALIFLPNVGLWSMYREKSLMKSHEPGEQGFPLGLNDGHIYTWT
DGLRRRDWHDYESIRKDGQRVGKGEHGKPYPLVEDECDDSVYKENGFNIYVSNNIALDRS
LPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDY
SDREHLKAHLAEYMSRFPKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINW
LPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGP
DPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCS
RVGHIYRKYVPYKVPSGTSLARNLKRVAETWMDEYTEYIYQRRPEYRHLSTGDLTAQKEL
RKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIRNAASGLCVDSKHGSTGTELRLD
NCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQNSPITLYDCHGMKGNQH
WSYRKDKSLYHLVSSGCMDCSPNDKRIFMNKCDPKSETQQWIFQKVNATVLDKFNSAASS
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaggcaaaagcgcgttctgcagatggcatttctgttcatggtggctttaatt
ttcctgccaaacgtcggcctttggtcaatgtacagagagaagagccttatgaagtcgcac
gagcctggagagcagggcttcccactgggcttaaatgacggtcacatttatacctggaca
gacggattgaggagaagagactggcatgactatgagagcatcaggaaagatgggcaacgt
gttggaaaaggagagcatggaaagccatacccgcttgttgaggatgagtgtgatgactct
gtgtacaaagagaatggtttcaacatctacgtcagcaacaatatcgctctggatcgctcg
cttcctgacatccgacatccaaactgtaagcagaagctttatcttgaaaacctcccaaac
acgagtatcatcatcccgttccacaatgaaggctggtcctctctgctcagaaccctccac
agcatcagcaaccgaacaccggatcacctgatcgcagagatcatactggtggatgactac
agcgacagagagcacctgaaggcacatctggcggagtacatgtccagatttcctaaagtc
cgtattgtgcgcactaagaagcgagagggtctaatccgcacacgacttctgggagcatct
gtggccagaggagaggtcctgacttttctggattctcattgtgaagccaacatcaactgg
ctgccacccttgcttgatcaaatcgcccaaaatcccaaaaccattgtatgccccatgata
gatgtgattgatcataatcactttgggtatgaagcgcaagctggggatgccatgagagga
gcttttgactgggagatgtactataaacgtattcctatcccacctgagctgcaaggacca
gaccccagtgacccatatcagtctcctgtgatggccggaggcttgtttgctgtaaaccga
cagtggttctgggagctgggaggttacgacacaggccttgagatctggggtggcgagcag
tttgaaatatccttcaaggtgtggatgtgcggaggcagcatgtacgatgtgccttgttcg
agggtgggccatatctacaggaagtacgtcccctacaaggtgccttcagggaccagcctg
gcaagaaacctgaagcgagttgcagagacatggatggatgagtacacagagtacatctat
cagcggcggcccgagtaccgccacctttccaccggtgaccttaccgctcagaaagagctc
cgaaaacacctcaaatgtaaagacttcaaatggtatatgaacactgtggcttgggacctg
cccaaatattacccacctgtggagccactgccagctgcctggggagagattcgtaacgca
gcatctggcttatgcgtcgactctaaacatggctctacaggcactgagctccgattggac
aattgtctgaaagagggcgcagagcgaacatgggcacatgagcagattttcacgtttggc
tggagagaggacatcaggcctggagatccactgcacaccagaaaattctgcttcgatgct
attagccagaacagccctatcacgctctatgactgccatggcatgaaaggcaaccagcac
tggagctacaggaaggataagtctttgtaccacctggtgagcagcggttgcatggactgc
agcccgaacgataagcggattttcatgaacaagtgtgatcccaagtctgaaacacaacag
tggatcttccagaaagtcaacgccaccgttctggacaaattcaacagcgccgccagctct
tag

KEGG   Danio rerio (zebrafish): 570248Help
Entry
570248            CDS       T01004                                 

Gene name
galnt2
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 2
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    570248 (galnt2)
   00514 Other types of O-glycan biosynthesis
    570248 (galnt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    570248 (galnt2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     570248 (galnt2)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   570248 (galnt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C Glyco_tranf_2_2 CDtoxinA RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 570248
NCBI-ProteinID: NP_001121823
ZFIN: ZDB-GENE-041111-110
Ensembl: ENSDARG00000003829
Vega: OTTDARG00000018244
UniProt: B0V0U4
LinkDB All DBs
Position
13
AA seq 559 aa AA seqDB search
MRRKSRMYLCFAVLWVLGIAYYFYSGTTLSRKDDWSGINSNRIQTHSNADDKDHSLESLP
LGKVRWQDYDQDLYVGATVVRPGQDPYARNKFNQVESDKLRMDRNIPDTRHDHCRHKQWR
TDLPASSVVITFHNEARSALLRTVISVLKKSPPHLVKEIILVDDYSDNPEDGALLGKIEK
VRVLRNDRREGLMRSRVRGADAATASVLTFLDSHCECNEHWLEPLLERVAEDKTRVVSPI
IDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTLEQRRARQGNPIAPIKTPMIAGGLFV
MDKDYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGG
SGTVFARNTRRAAEVWMDDFKNFYYAAVPSARNVPYGNIQSRLEMKKRLGCKPFKWYLEN
VYPELRVPDHQDIAFGALQQGQNCLDTLGHFADGVVGVYECHNAGGNQEWALTKDKSVKH
MDLCLTVVDRTAGSQIKLQGCRENDTRQKWEQIDNNTKLRHVGSNLCLDSRSARSGGLTV
EVCSPSLTQQWKFTLNLQP
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggaaatctaggatgtatctatgtttcgctgtgctttgggttctgggcatagct
tattatttctattcgggaacaacgctgagtcgaaaggatgactggagtggcattaattca
aaccgaattcaaacacacagcaatgcagatgacaaagaccacagccttgaaagtcttcct
ctagggaaggttcggtggcaggactatgaccaggatctatatgttggagcgactgtggtg
cgtccagggcaggatccctacgccagaaacaagttcaaccaggtggagagtgacaaactc
cgaatggaccgcaacatcccggacactagacatgaccattgtcgtcataagcagtggaga
acagatctacctgcatccagtgtggtcattactttccacaatgaggcccgttcagccctg
ctgcgcactgtcatcagtgtgctgaagaagagtcctcctcatctggtcaaggagatcatc
ttggtggacgactacagtgacaaccctgaagacggtgccttacttgggaaaattgagaaa
gtcagagtcctgaggaacgaccgtcgagagggcttgatgcgatctcgagtgcgaggggcg
gatgcagccacggccagtgtactgaccttcctcgacagccactgcgagtgtaatgaacac
tggttggagcccctgctagaaagggttgctgaggataagactcgggttgtgtcgcctatc
atagatgtcattaatatggacaatttccagtatgtgggggcatctgcagatcttaaagga
ggttttgattggaatctggtttttaaatgggactacatgaccctggaacaaagacgagct
cgacaaggaaaccccatcgctcctatcaagactcctatgattgccggtggtctgtttgta
atggacaaggactactttgaggagctgggcaagtacgacatgatgatggacgtgtggggc
ggtgagaatctcgagatctccttcagagtgtggcagtgtggaggcagtctggagatcatt
ccctgcagtcgagtgggtcacgtattcaggaaacaacatccatacacttttcctggaggc
agcggcactgtctttgccagaaacacgaggcgagcggcagaagtttggatggatgacttc
aagaatttctactacgccgctgtgccttcagcccgtaatgtgccgtatggaaacattcag
agcaggctggaaatgaagaagagattgggctgcaaaccatttaaatggtacctggagaac
gtctatcctgagctgcgagtgccggatcatcaggacattgcatttggagctcttcagcag
ggtcaaaactgtctggacacactgggccattttgcagatggtgtggtgggggtttacgag
tgccacaacgctgggggcaatcaggaatgggccctgaccaaagacaaatcggtgaagcac
atggacctgtgcctgacagtggtggaccgcacagctggctcacagatcaagcttcagggc
tgcagggagaacgacaccagacagaaatgggaacagatcgacaacaacaccaagctacgt
cacgtgggcagcaacctgtgtctggacagccggagcgcaaggagcggaggcctgacggtg
gaggtgtgcagcccgtcgctcactcagcagtggaagttcaccctcaacctgcagccgtag

KEGG   Danio rerio (zebrafish): 797549Help
Entry
797549            CDS       T01004                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    797549 (galnt9)
   00514 Other types of O-glycan biosynthesis
    797549 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    797549 (galnt9)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     797549 (galnt9)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   797549 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 797549
NCBI-ProteinID: XP_001338018
ZFIN: ZDB-GENE-060526-21
Ensembl: ENSDARG00000006832
UniProt: F1Q6D3
LinkDB All DBs
Position
5
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELVQIGRLSDQRLRGRNAKVTNSMD
RQSILKRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGEDSRETEGRFEEYGY
NAQLSDRISLDRNIPDYRPKKCKQLTYSDDLPQISVVFIFVNEALSVILRSVHSMVNHTP
AHLLKEIILVDDNSDSVELKFNLDHYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAP
VVGFFDAHVEFNTAWAEPILTRVKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDRGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEFKSHVYMAWNIP
MNNPGVDFGDVSERVALRKKMNCKSFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLD
QGSEEDERAILYPCHGMSSQLARYTTEGLLQLGPLGSTTFLPDTKCLVDDGRGRTPSLKK
CDSVTRSSQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HPRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaagatcaaaactctgctgacggtcaacattctggtgttcgtcggg
atcatcctgttctcggtctactgcaggatccaggaccggtcggaggagctcgtgcagatc
gggagactgtcggaccaaaggctgcgaggcaggaatgccaaagttacgaactccatggac
aggcagtccattcttaagagactcgagcgactggaagatgtggtctataatcagttaaat
ggtctagccaagcccatgggtctggtggagggtcctggaggtctaggacagggcggtgct
gctgccacgctgggagaggacagccgggagactgaagggagattcgaggagtatggctac
aacgctcagctgagtgaccgcatctccttggacaggaatattccggactacaggcccaaa
aagtgtaagcagctgacctactccgatgaccttccccagatctctgtggtcttcatcttt
gtgaacgaagctctttctgtcatccttcgctcagttcacagcatggtcaaccacactccg
gcacatctgctcaaagaaatcatcctggtggatgacaacagcgacagcgtggagctaaag
ttcaatctggatcattatgtgaataaacgatatcctggcctggtgaagatcgtgaggaac
agtaagagagaaggcctcattcgtgccaggattcacggctggaacgcagccactgctcct
gttgtaggcttctttgacgctcacgtggagttcaacacagcctgggctgagccgatcctc
accagagtgaaagaagatcacactaggataatcctccctgcgatagataatatcaagtac
aatacctttgaggtgcagcaatacgctaatgcggctcatggctacaactggggcctgtgg
tgcatgtacatcatcccgcctcaggattggctggacagaggagatgaaactgctccaatc
aggactccagcaatgatcggctgctcttttgtagtggatcgtgaatattttggagagatc
ggtctgcttgatccgggcatggaggtctatggaggagagaacattgaacttgggatgagg
gtttggcagtgtggtggcagtatggaggttcttccatgtgccagagtcgcacatattgaa
cgcacaaagaaaccatacaacaatgacatcgattactatgctaagaggaatgcgctgcgt
gcggcagaagtctggatggatgagttcaagtcccatgtctacatggcctggaatattcct
atgaacaacccaggagtagattttggagatgtgtcagagcgtgtggcactgaggaagaaa
atgaactgcaagagcttccgctggtacctcgagcatgtatatcctgagatgagaatctac
aataacaccatcacttatggagaggtgcgaaacagtaaagccagcgggtactgtcttgat
cagggctcagaggaggatgagagggccatactctacccttgtcacggcatgtcatcgcag
ctggcaagatacaccactgagggcttattgcagttaggacccctggggtcaactacgttt
ctgcctgacacaaaatgcctggtggatgatggaagaggaaggactccaagcttgaaaaaa
tgtgattctgtcacccggtcttcccagaggctctgggattttactcagaatggccctatc
ataagtcgagacacgggacgctgtttggaggttgaaatgtcaaaagatgcgaactttggc
ctgcggctggtggtccagcgctgctcagggcagaaatggatgattcggaactggataaaa
caccccagacactga

KEGG   Danio rerio (zebrafish): 799387Help
Entry
799387            CDS       T01004                                 

Gene name
galnt16
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 16
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    799387 (galnt16)
   00514 Other types of O-glycan biosynthesis
    799387 (galnt16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    799387 (galnt16)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     799387 (galnt16)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   799387 (galnt16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_7C DUF4227
Motif
Other DBs
NCBI-GeneID: 799387
NCBI-ProteinID: XP_001339749
ZFIN: ZDB-GENE-131120-189
Ensembl: ENSDARG00000053190
Vega: OTTDARG00000038954
UniProt: X1WGF8
LinkDB All DBs
Position
17
AA seq 567 aa AA seqDB search
MMRRIRANAILILTVAWILGTFYYLWQDSKPSASSSSSSSSSAGSQQKIHGQKSSSGRLE
ERTLPLIVTRAPQLEQQGQLLGLFDEKAFLSSKQLRPGEDPYREHAFNLQESDRLGSERA
IRDTRHYRCASMTFDPDLPPTSIIITFHNEARSTLLRTIKSVLMRSPPHLILEIILVDDF
SSDPEDCRLLSQIPKVRCLRNERREGLIRSRVRGASAASASILTFLDSHCEVNTDWLQPM
IQRVKEDHSRVVSPIIDVISLDNFAYLAASADLRGGFDWSLHFKWEQIPIEQKMARNDPT
QPIRTPVIAGGIFVIEKGWFNHLGQYDTHMDIWGGENFELSFRVWMCGGSLEILPCSRVG
HVFRKRHPYDFPEGNALTYIKNTRRAAEVWMDDYKQYYYAARPSAQGKAFGSIADRLALK
RKLNCNSFRWYLENVYPELKIPEQEEAYSLLKQGGLCLESHGTDSLGLAECRSTPSIPAS
QKWTLIEPQIRQHDLCLAITAFTAGSKVRLEPCNIKESRQKWKPRGPALQHMISGLCLDS
QPPSGPPAIAQCRPQVASQSWEPQLVT
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcaggattcgggccaacgccatcctcatcctcaccgtggcctggatcctcggc
accttctattacctgtggcaggacagcaaaccctccgcctcctcttcgtcctcctcctcc
tcctctgcgggctcccagcagaagatccacgggcagaaatcctcctccgggaggctggag
gagcgcactcttcctctgatcgtaactcgtgcgccgcagctggagcagcagggtcagctc
ttgggcttgttcgatgaaaaggcgtttctgtccagtaagcagctcaggccaggtgaagat
ccctatagggagcatgccttcaacctgcaggagagcgaccggttaggcagcgagcgcgcc
attagagacacacgccactatcgatgtgcctccatgacctttgaccctgacctgccgccc
accagcatcatcatcacgttccacaatgaggctcgctccaccctgctgcgcactatcaag
agtgtactaatgagaagcccacctcatctgatactggagattattcttgtggacgacttt
agctctgatcctgaagactgtcggctgctctctcagatcccgaaggttcgctgcttgaga
aatgaacggcgggaaggtctgatcaggtctcgggtcagaggagcgtctgcggcttcagcc
tccatcctgaccttcctggacagccactgcgaggtcaacactgactggctgcagcccatg
atccagagagtcaaagaggatcacagccgtgtggtcagccccatcattgatgtcatcagt
ctggataacttcgcttacctggctgcttctgcagacctgagaggaggtttcgactggagt
ttacacttcaagtgggagcagattcctatagagcagaaaatggccagaaatgaccccaca
cagcccatcaggacgcctgtaatagctggcggaatcttcgtgatagagaagggctggttt
aatcacctgggccagtacgacactcacatggatatttggggcggtgaaaactttgagctg
tcgttcagggtgtggatgtgtggcggcagtctggagatcctgccgtgcagtcgcgtgggc
cacgtcttcaggaaacgacacccctatgacttcccagagggcaatgcactcacctacatc
aagaacacacggagagctgctgaggtctggatggatgattataagcagtattattacgct
gcaaggccatcagcgcagggcaaggccttcgggagtattgcagatcggcttgctctgaaa
aggaagttgaactgtaactctttccgatggtatctggagaacgtgtaccctgaactcaaa
attccagagcaggaggaggcgtacagtcttctcaaacagggtggtctgtgtctggagagc
cacggcactgacagtctgggtttagcggaatgtaggagcacacccagtataccagcctca
cagaagtggaccctgattgagcctcagatccgtcaacatgacctgtgtttggccatcaca
gccttcaccgcagggtccaaggtcagactagagccctgcaacatcaaagagtccagacag
aaatggaagcctcgaggtccggcacttcagcacatgatcagcggcttgtgtctagacagt
cagcctccctcagggcctccagccatcgctcagtgccgcccccaggtggccagccaatcc
tgggagccccagctggtcacctga

DBGET integrated database retrieval system