KEGG   Danio rerio (zebrafish): 100188894
Entry
100188894         CDS       T01004                                 

Gene name
il4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04060  Cytokine-cytokine receptor interaction
dre04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100188894 (il4)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100188894 (il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    100188894 (il4)
   00536 Glycosaminoglycan binding proteins [BR:dre00536]
    100188894 (il4)
Cytokines and growth factors [BR:dre04052]
 Cytokines
  Interleukins
   100188894 (il4)
Glycosaminoglycan binding proteins [BR:dre00536]
 Heparan sulfate / Haparin
  Cytokines
   100188894 (il4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 100188894
NCBI-ProteinID: NP_001164211
ZFIN: ZDB-GENE-100204-1
Ensembl: ENSDARG00000087909
Vega: OTTDARG00000036475
UniProt: D1YSM1
LinkDB
Position
14
AA seq 127 aa
MRTFLLLVLTLVPVSESKLKIDEILLMEIIQSVNGILNGKGEKMDLDQFIPDIYETGHYS
KKTLCQAGMALKGKIPSRSHLQRQLNAYAAYTGTGNCSVSTSGECTMKEFLEKTKACCHY
LYSAQRT
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaggactttcttgctgttggtacttacattggtccccgtttctgagtcgaaactcaaa
atagatgaaattctgctaatggaaatcatccagagtgtgaatgggatcctgaatgggaaa
ggggaaaaaatggatcttgaccagtttatacctgacatatatgagacaggacactactct
aagaaaactctctgccaagcaggaatggctttgaagggtaaaattccaagcaggtctcat
ctacagagacagctgaatgcttatgcagcatataccgggactggaaactgcagcgtttcg
acctcgggggaatgcacaatgaaggagtttctcgaaaaaaccaaagcatgctgccattat
ctatactcggctcaaaggacataa

DBGET integrated database retrieval system