KEGG   Danio rerio (zebrafish): 100330695Help
Entry
100330695         CDS       T01004                                 

Gene name
galnt13
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 13 isoform X3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100330695 (galnt13)
   00514 Other types of O-glycan biosynthesis
    100330695 (galnt13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100330695 (galnt13)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100330695 (galnt13)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   100330695 (galnt13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C Glyco_tranf_2_2 RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 100330695
NCBI-ProteinID: XP_002663357
ZFIN: ZDB-GENE-091204-444
Ensembl: ENSDARG00000099227
Vega: OTTDARG00000032767
UniProt: A0A286Y879
LinkDB All DBs
Position
9
AA seq 556 aa AA seqDB search
MRRFVYCKVVLTTSLVWVLVDVFLLLYFSECNKCDNRKDHSLLPALRAVMSRAHEAPGEM
GKAVVIPKEEQDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIV
IVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVPVRIL
RMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVI
SDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRT
YFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQV
INKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPD
SQIPRRYYSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDL
CLDASRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLKDCS
GRRSQQWILRNMTLGV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagacgcttcgtgtactgtaaggtggtcctgaccacctctctggtgtgggtgctagtg
gatgtcttcctcttgctatacttcagtgagtgcaacaaatgtgataaccggaaggaccat
tcactcctgcctgcgctcagagctgtgatgtcacgtgcccatgaggctccaggtgaaatg
gggaaggctgtggtgattcccaaagaagagcaggacaagatgaaagaactctttaaaatc
aatcagttcaacctgatggccagtgacatgatcgcgcttaacaggagtctgccagatgtc
aggctggatggctgtaagacgaagacctaccctgatgaccttccaaacaccagcattgtt
atcgtgtttcataatgaggcatggagtacactgctaagaaccgtacacagcgccataaac
cgctcgcccagacaactgctgtatgagatactgctggtggatgatgctagtgaaagagat
tttctaaaggaaaaattggaggactatgttgcaactctggaggttccggtgcgaattttg
aggatggagcagcgaactggtttgattcgagcaaggctgagaggggcagccgccacacga
ggacaggtcatcacctttctggatgcccactgtgagtgcactacaggctggctggagcct
ctgatggcacggatcaaagaggacaggagggctgtggtctgcccgattattgatgtcatc
agtgatgagacatttgagtacatggccggctcagatatgacctatgggggattcaactgg
aaactcaactttagatggtatccagttcctcagagagagatggaccgccgtaaaggggac
cggacccttcctgtaagaactcccacgatggcaggaggtctgttctctattgaccgaacg
tattttgaagagattggcacctatgactcagggatggatatatggggaggcgaaaatctt
gagatgtctttcaggatctggcaatgtggaggatctctagagatagtgacatgttctcac
gtcggacatgtgttccggaaagccacaccttacagctttccgggcgggactggtcaggtg
ataaacaagaacaacagacgattggctgaagtctggatggacgagtttaaagatttcttc
tacatcatctcaccaggtgtggttcgggtagattatggggatgtttcttctcggaaggct
ttgagagaatctctgaagtgcaaaccattctcatggtacctggagaacgtataccccgat
tctcagattccccgcagatattactccctcggggagatcaggaatgttgagaccaatcag
tgtgttgataacatgggccgtaaggagaatgaaaaggttggcttcttcaactgtcatgga
atgggaggaaaccaggtattttcatacactgctgacaaagaaatccgtacggatgacctg
tgtctggatgcatcacgactgaatggacctgttgttatgctgaagtgccaccacatgaag
ggaaaccagatgtttgaatatgatgcagagcgtctgactctgctccatgtgaacagtaac
cagtgtctggacatgccttctgaagaggataagatggttcccactctcaaagactgtagc
ggcaggcgctcacagcagtggatcttgaggaacatgacgctaggcgtctga

DBGET integrated database retrieval system