KEGG   Danio rerio (zebrafish): 100332111
Entry
100332111         CDS       T01004                                 

Gene name
shc3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100332111 (shc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100332111 (shc3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100332111 (shc3)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100332111
NCBI-ProteinID: XP_021324876
ZFIN: ZDB-GENE-130312-2
LinkDB
Position
21
AA seq 632 aa
MLHRAKYNRFRNESVTSVDELLHGLSMNAKVSAVPPSPPVGDPPYAPPADPDPAEESGTL
CTLINKVSNLKFTNSSGLLGIKGLPSAVKDLAVSKLQGGAAAGASSSPASSTLAAASPLE
PGSTSSGKKGRMEESQPSGEGWSLGGTGAAGCGGLVNKPSHGWLHSSEKISGPGVTYVVK
YLGCIEVLRSMRSLDFTTRSQITRYEHTLCIHTQKTLKDLKQSCCAMNGLYAQCPSLFQT
PSKLLSSILGKSNLQFAGMSINLNISTSSLNLMTPDSKQIIANHHMQSISFASGGDPDTT
DYVAYVAKDPVNRRACHILECSDGLAQDVISTIGQAFDLRFQLYLQCPSSKPSSIHDRVM
STDEPPWTEEGDETADHHYYNSIPGKMPPPGGFIDARLTNQSQDSSQGAGVDQTYYQGRP
MFIQQGSCDIYSLPEVKAQPPKAGEVPTYVNTQHIDTQVLAALQAETETNADSSTTGAPK
DSPRKDLFDMKPFEDAIMTQTPAASELHKAASVDNSSPLLMRAAALRAHEELEDQRWYHG
EMSRRQAEKLLLHDGDFLVRKSTTNPGSYVLTGMHNGLAKHLLLVDPEGTVRTKDHIFES
ISHLIGHHRDNNLPIVSAGSELCLKQPVDRKQ
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgcttcaccgtgctaaatacaaccgattccggaatgagtcagtgacgtccgtcgatgag
cttctgcacggtctctccatgaacgccaaggtctcggccgtcccgccgtcaccgcccgtg
ggcgaccctccatacgccccgccagccgaccctgaccccgccgaagagtctggcaccttg
tgcaccctcatcaacaaagtctccaacctcaaattcaccaactcttctggacttctaggc
attaagggcctgccgtccgctgtcaaagacctggccgtgtccaagctccagggaggagcg
gcagcaggtgcttccagcagccccgcttcatccaccctcgctgcggcctccccgctggaa
cccggctccacgagttcagggaagaagggccgaatggaagaatctcagcctagtggagag
ggatggagcctgggcgggacgggggccgcgggctgtggagggctggtgaataagccgtct
catggatggctacactccagcgaaaagatctctggacctggagtgacgtatgtcgttaag
tatctgggctgcatcgaggttcttcgctccatgagatctctggacttcaccacacgctca
cagatcacacggtacgaacacactctctgtattcatacacaaaaaacgctaaaagaccta
aaacagtcatgctgtgcaatgaatgggctatatgcacaatgtccgtctctctttcagact
ccctccaaactcctctccagtattttgggcaagagtaacctgcagttcgctggcatgagc
atcaacctcaacatctccaccagcagtttaaacctgatgacacccgactctaaacagata
atagccaatcatcacatgcagtccatatcctttgcctccggtggagatccggacacgact
gattacgtcgcttatgtggccaaggatcctgttaaccggagagcctgtcatattctggaa
tgctctgacggtctggctcaggacgtgatcagtacgatcggtcaggcgtttgacctgcgc
tttcagctctacctgcagtgtccctccagcaaaccctcgtccattcacgacagagtcatg
agtacagacgagccgccctggacggaggaaggagacgagaccgcagatcatcactattat
aacagcatccctggaaagatgccgccgcctggaggattcatcgacgccaggctgaccaat
cagtcgcaagacagcagccagggtgcaggagtggatcaaacttactaccagggccgaccc
atgttcatccagcaagggtcatgtgacatctacagtctccctgaggtcaaagctcagcct
cctaaagctggagaagtgcccacgtatgtgaacacgcagcatatcgacacgcaggttttg
gcagccctgcaggcagaaacagagaccaatgcagattcgagcacgactggggctcccaaa
gacagcccgaggaaagacctcttcgacatgaagccgtttgaggacgctatcatgacccag
actcctgcagcatcagagcttcataaagcggcgtcggtggataattccagtcctctgctg
atgcgagccgctgccctgcgtgcccacgaggagctggaggaccaacgctggtaccacgga
gagatgagccgccggcaggctgagaaactgctgctgcacgacggagacttcctggtgcgc
aagagcaccacaaacccgggctcgtacgtcctgacggggatgcacaacggcctcgccaaa
cacctgctgctggtcgaccctgagggcacggttcggacgaaagatcacatattcgagagc
ataagccacctgattggccatcaccgtgacaacaacctgccaatcgtgtctgcgggcagt
gaactgtgtttgaagcagccggtggacagaaaacagtga

KEGG   Danio rerio (zebrafish): 323818
Entry
323818            CDS       T01004                                 

Gene name
shc1
Definition
(RefSeq) SHC-transforming protein 1 isoform X3
  KO
K06279  SHC-transforming protein 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    323818 (shc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    323818 (shc1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    323818 (shc1)
SSDB
Motif
Pfam: PID SH2 PGM_PMM_IV
Other DBs
NCBI-GeneID: 323818
NCBI-ProteinID: XP_005169812
ZFIN: ZDB-GENE-030131-2538
Ensembl: ENSDARG00000075437
Vega: OTTDARG00000033203
UniProt: E7F3T0
LinkDB
Position
16
AA seq 454 aa
MEYVDMNRLGGASRRARVEGGQLGGDEWTRHGSFVNKPTRGWLHSDIVVSTSGVSYTVRY
MGCVEVLQSMRALDFNTRTQVTREAISVVCEAVPGAKGAQRRRKPSSRCLSSILGKSNLQ
FAGMTITLTVSTSSLNLMAIDCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRA
CHILECSEGLAQEVISTIGQAFELRFKQYLKNPPKVVTPHDRMAPFDGSAWEEEEEDLAP
PPEVPYYNNFPGKQPPPGGLVDMRTRPGHSTGPTLPYGQPSQNDIHKQPLPPLPVGVKDG
GLFDDPSYVNVDKPRLPASAAANGNAHRDAFDMKPFDAALVVSGAVALPLAEQLQNEPWF
HGPLSRRQAERLLTKDGDFLVRESGTTPGQYVLTGQQGGQPKHLLLVDPEGVVRTKDHRF
ESVSHLISYHMDNRLPIISAGSEVCLQQPVDRKA
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggagtatgtggatatgaaccggctgggcggggcctcacggagggcccgtgtggaaggg
ggccagctcggcggagatgagtggacacggcatggctcctttgtcaacaagcctacccga
ggctggctgcactcggacattgtggtcagcaccagcggagtctcctacactgtcaggtat
atgggctgcgtggaggtgctgcagtcaatgagagcactggacttcaacaccagaactcag
gttaccagggaggcgatatcagtggtgtgtgaggcggtaccaggtgccaaaggagctcag
cgaaggagaaagccctcctctcgctgtctgtcctccatcttagggaagagtaatctccag
tttgctggaatgacaatcaccctcaccgtgtcgaccagcagtctgaacctaatggccatc
gactgcaaacagattatcgccaaccatcacatgcagtccatctcttttgcatcaggagga
gatccagacacagcggagtatgttgcatacgtcgccaaagaccccgtcaatcagcgagcg
tgtcatatcctggagtgctctgaaggcttggctcaggaggtcatcagcaccataggtcag
gctttcgagctccgctttaaacaatacctaaaaaacccacccaaagtggtcaccccccat
gaccgcatggctccgtttgatgggtcagcgtgggaggaagaggaagaagatctggctcct
ccgccagaggtgccatattacaacaacttccccggcaaacagcctcctcctggtggttta
gtggacatgaggacccgtcccggacacagtacaggacccacgctgccctatggacagccg
agccagaacgacattcacaagcagcctcttcctccactaccagtgggtgttaaggatgga
ggcttgtttgacgacccctcatacgttaatgtggataaaccccgcctcccagcatcagca
gcagccaatggaaatgctcatagagacgcgtttgacatgaaaccgtttgatgcagcgctc
gttgtgtcgggtgcagtggcacttcctctggcagagcagctgcagaacgagccctggttt
cacgggcctctgagccgcaggcaggccgaaagactcctgaccaaggatggagacttcctg
gtgcgggagtcaggcaccacaccaggccagtacgtcctcacgggacagcagggcggacaa
ccaaaacacctgcttctggtggatccagagggagtggtgcgcaccaaagaccaccgcttt
gagagcgtcagtcacttgatcagctaccacatggacaaccggctgccaatcatctctgca
ggaagtgaggtgtgtctgcagcaaccggtcgatcgcaaagcttga

KEGG   Danio rerio (zebrafish): 562011
Entry
562011            CDS       T01004                                 

Gene name
shc2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    562011 (shc2)
   04370 VEGF signaling pathway
    562011 (shc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    562011 (shc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    562011 (shc2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 562011
NCBI-ProteinID: NP_001038438
ZFIN: ZDB-GENE-050208-666
Ensembl: ENSDARG00000062080
Vega: OTTDARG00000010362
UniProt: Q1LX18
LinkDB
Position
22
AA seq 501 aa
MNRRTRVEGIWLGDNFTQKGSFINKPSQGWLHPDKKISSTGASYIVRYMGCIEVLKSMRS
LDFSTRTQVTREAINRLCESVPGGKTAWKKKTTNKTLQSIMGKSNLRFAGMSIGVNISID
GLSLLVPTTRQVIAHHPMQSISFASGGDSDTPDYVAYVAKDPVNQRACHILECCDGLAQN
VISTIGQAFELQFKQYLHSPPKAIPAMDSHAEYPNILSRNIRTEESAWGEDEESSEHDYY
NSIPGKEPPVGGVVDSRLRPPAGLLGHVHTHPQSKTSQMGSPAKRDANSLPATHLCYEVH
WDTENNRSSSLTSDGYLRADGHPPGSRDYEEHLYVNTQNLDNLEASVVGRRPESPKKDIF
DMRPFEDALRLHEASGVCVLEDKWPSPPRRRAPVAPTEDQLRREMWYHGRMSRRDAENLL
GRDGDFLVRDSATNPGQYVLTGMQCGLPKHLLLVDPEGVVRTKDMLFESISHLINYHLTN
KLPIVAAESELHLQQVVCRKI
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaaccggaggaccagggtggagggaatatggctcggggataacttcacccagaagggc
agcttcatcaacaagccgtctcaagggtggttgcacccagacaaaaagatcagcagcaca
ggggcttcctacatcgtcaggtacatgggctgcattgaggtcctcaaatccatgagatcg
ttggacttcagcaccaggacgcaagtcacaagggaagccatcaacaggttgtgtgaatct
gtacctggaggaaaaactgcctggaagaagaaaacaacaaacaaaacccttcagtccatc
atgggcaaaagtaacctgcgctttgctggaatgagcatcggcgtcaacatctccattgat
ggcttgagtctcctcgtccctacaacacggcaggttattgcccatcatcccatgcagtcc
atatctttcgcctcaggtggagattcggatacacctgattacgtcgcctatgtagccaaa
gaccccgtcaaccaaagagcttgtcacattttggagtgctgcgacggtcttgcccagaat
gtgatcagcaccattggccaggccttcgaactgcagttcaaacagtacctacacagtcca
cccaaagccattcctgccatggatagtcatgctgaatatcctaatatattgtctagaaat
ataagaacagaagagtcagcatggggtgaagacgaggagtcatccgagcacgattactac
aacagcatccctggaaaggagcctcctgttgggggagtggtagactcgaggctcaggcct
cctgcgggcctactgggccacgttcacacacacccacagagcaaaacatcacagatgggg
tcaccggctaaaagagacgcaaacagccttcctgccacccacttgtgttatgaagtgcac
tgggacacagagaataacagaagctcaagtttgacttctgatggttacttgcgagcagat
ggtcatcctccaggcagtcgtgattacgaggagcatctgtacgtaaacactcaaaatctg
gacaacctggaggcctcagtggttgggcgcagacctgagagccccaagaaggacattttt
gacatgaggccatttgaagatgccctgcgcctccatgaagctagtggggtttgtgtgctg
gaggacaaatggccgagtcccccacgtcgcagagcccctgtggcccctacagaagaccag
ctaagacgagagatgtggtaccacggccgaatgagccgcagggatgctgagaatctgctg
ggccgcgatggggatttcctggtacgggacagcgctactaacccaggccagtacgtgctg
acggggatgcagtgcggccttcctaaacatctgctgctggtggatcctgaaggagtggtc
cgaactaaagacatgcttttcgagagcatcagtcacctgatcaactaccatctgacaaac
aagctgccgattgtagcggcggagagcgaactacacctccagcaggtcgtctgccgaaaa
atctga

DBGET integrated database retrieval system