KEGG   Danio rerio (zebrafish): 100332784Help
Entry
100332784         CDS       T01004                                 

Gene name
si:ch73-12o23.1
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X2
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00052  Galactose metabolism
dre00500  Starch and sucrose metabolism
dre01100  Metabolic pathways
dre04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100332784 (si:ch73-12o23.1)
   00500 Starch and sucrose metabolism
    100332784 (si:ch73-12o23.1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100332784 (si:ch73-12o23.1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    100332784 (si:ch73-12o23.1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100332784 (si:ch73-12o23.1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100332784 (si:ch73-12o23.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 GHL15
Motif
Other DBs
NCBI-GeneID: 100332784
NCBI-ProteinID: XP_002660410
ZFIN: ZDB-GENE-130530-749
Ensembl: ENSDARG00000074282
Vega: OTTDARG00000032899
UniProt: E7FCP7
LinkDB All DBs
Position
1
AA seq 956 aa AA seqDB search
MVSYERLTPEEVHFSGAALLDNDESTDADLKEGDPELPLLPQSPRCSITAALLTLGGLIV
VLSAVWLLGTLFWIHNPPSTESHRPPSPKSQNGTGLQPESCSQVPEGWRFDCYPERNVVV
TEDMCHARNCCFIQSSRGNVSAQNGVPWCFYTPDYPSYELMSIVDTEMGKVGKLLRNKKT
YYPKDIDALQLEVLFEEDHRLRVKITDPTEKRYEVPIDVPVVHKRASNPSYTVDFIKEPF
GLIVKRTQTGAVLLNTSIAPLFYADQFLQMSSSLPTRFIYGLGEHRSNFLHDVQWNTLTM
WARDVPPMELTNLYGVHPFYLSMESDGNAHGFFMLNSNAMDVVLQPAPAVTWRMIGGILD
FYIFLGPDPSSVIGQYLDVVGKPAMPIYWALGYHLCRWGYKTSNKTWSVVKEMRNYGIPQ
DVQWNDIDYMDRSLDFTYDPSGFSTLPDLVKDLQRHDQHYVMILDPGISNSQPPGSYWPF
DEGKKKGIFINDSNGDILIGKVWPGLTAFPDFSNPDTHEWWYQNLQRFHNKVPFDGVWID
MNEPSNFFDGSLNGCPDNELENPPYTPGILGGTLKGKTVCASARQKISVHYNIHSLYGLM
EAQATESALRRITKKRPFIISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFNILG
IPLIGADICGFGGSTTEELCVRWTQLGAFYPFTRNHNSIDEQDQEPTAFSPAARTAMKEA
ILLRYSLFPHLYTLFHHAHVSGHTVATPLLFQFPTDEKTYGIDKQFLWGKSLLVTPVLDA
GRDYVVGYFPKGLWYDFHTGNSLISSGEEIKLEAPADKINLHLREGSVIPTQRPNTTLWV
SSGQPLHLIVSLSEDGRAKGDLYWDDGETIDSYESNQYAYIYFTVEQNTMMSEVLHNHEE
ATYITVETASFYGVKAKPENVTVNSQEAAFTYLDNQVLTVTDLGLNLSHNFTISWM
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcctacgagagactcacccccgaggaggttcacttctccggagctgcattattg
gataatgacgagtcgacagacgcagatctaaaagagggggacccagagctgcctctgctg
ccccagagccctcgctgctccatcactgccgccctgctgaccctcggggggctcattgtt
gtcctctctgccgtctggctcctcgggaccttattttggatccacaatccaccctctaca
gaatcccataggcccccttcacccaaaagccaaaacggaacagggctgcagccggagtcc
tgctctcaggtgcctgaagggtggaggtttgactgctatcctgaaagaaatgtggtggtg
acggaggacatgtgccatgctagaaactgctgctttattcagagctcacggggcaatgtt
tcggcacagaatggagtgccatggtgtttttacactcctgattatccgtcctatgagcta
atgtctattgttgatacggagatgggcaaggtgggaaagctgctcaggaataagaagaca
tactatcccaaagacatcgatgctcttcagctggaggtgctgtttgaggaggaccacagg
ctgcgtgtgaagataacagacccgactgaaaagaggtacgaggtgcctatagatgtccct
gtggttcataaaagagcctcaaacccctcgtacactgtagacttcatcaaagagccgttt
ggactgatagtcaagagaacgcagactggagctgtactgctgaacacatccatcgctcct
ctcttctacgcggatcagttcctccagatgtcctcatctctacccacacgtttcatctac
ggactgggtgaacatcgctccaactttctgcatgatgtccagtggaacactctcaccatg
tgggctcgagatgttcctccaatggagctcaccaacctctatggtgtccaccctttttat
ctttccatggaatctgatggaaatgcacatggatttttcatgctcaacagtaatgcaatg
gatgtggttttgcagcctgcaccagctgttacctggcgtatgattggtgggatcctcgac
ttttacattttcttaggcccggatcctagctctgtgattggacagtatctggatgttgta
ggaaagcctgctatgcccatctactgggctcttgggtatcatctgtgccgatggggctac
aagacaagcaacaaaacctggagtgttgtaaaagaaatgcggaattatgggatacctcag
gatgttcagtggaacgatattgactacatggatagaagtctagacttcacttacgaccct
tcaggcttttccacccttccagacctggtgaaagaccttcaacgacacgatcaacactat
gtcatgattctggatcctggaattagtaactctcagccacctggctcttactggccgttt
gatgagggtaagaagaagggcatcttcatcaatgactcaaatggagacatccttattgga
aaggtttggccaggactaactgcttttccagatttctccaatccggacactcatgaatgg
tggtaccagaatctgcagagatttcataacaaagtgccattcgatggcgtgtggattgac
atgaatgagccgtctaacttttttgatgggtcactgaatggttgtccagacaatgaactg
gaaaatcctccctacacaccaggtattctgggtggtacattgaagggcaagactgtgtgt
gcatctgcacgtcagaagatctctgttcactataacatacacagtctgtatggactcatg
gaggcacaggctactgaaagtgctttgaggaggatcacaaagaagcgtcccttcattatt
tcccgctctacgtttcccagtcagggcaagtattcaggccactggctcggagacaacagg
agccagtggaaagatctggccacatctataccaggtatgctgacatttaacatcctgggc
attcctctgattggagcagacatttgtgggtttggcggcagcactacagaagagctgtgt
gtgcgatggacgcagctcggagctttttaccctttcacaagaaaccacaactccattgat
gaacaggatcaggaaccaactgcattcagtcctgcagctcgtacggcaatgaaagaagcc
atccttcttcgctattccctgttcccacatctctacacactcttccatcacgcacacgtc
agcggacacacggtcgccacaccactgcttttccagttccctactgatgaaaagacgtat
gggattgataaacagttcctatgggggaagagtttgcttgtcacaccggttttggatgca
gggcgagattatgttgtgggatatttccctaaaggtctctggtatgactttcacacgggg
aactcattgataagcagtggagaagaaatcaagcttgaggctccagcagacaaaatcaac
ctgcatctcagagagggatcagtcatacctacacagagaccgaacaccacattatgggtg
agcagcggtcagcctcttcatctgattgtgagtctgagcgaggacggccgggccaagggt
gatctgtactgggatgatggagagaccattgactcgtatgagagcaatcaatacgcttac
atctatttcacagtagaacagaacacaatgatgtcagaggtgctgcataatcatgaggag
gccacttacatcactgtggagaccgcctccttttatggagtgaaggcgaagccagaaaat
gtcaccgtgaattcgcaggaggcggcgttcacttaccttgacaatcaggtgctgacggta
acagacctgggtctgaacctcagtcataacttcacaatcagttggatgtaa

DBGET integrated database retrieval system