KEGG   Danio rerio (zebrafish): 100333154Help
Entry
100333154         CDS       T01004                                 

Gene name
gxylt1a
Definition
(RefSeq) glucoside xylosyltransferase 1-like
  KO
K13676  UDP-xylose:glucoside alpha-1,3-xylosyltransferase [EC:2.4.2.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100333154 (gxylt1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100333154 (gxylt1a)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     100333154 (gxylt1a)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  O-Glycan
   100333154 (gxylt1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_8 DUF2512 CMAS
Motif
Other DBs
NCBI-GeneID: 100333154
NCBI-ProteinID: XP_017209692
ZFIN: ZDB-GENE-110314-1
Ensembl: ENSDARG00000076111
LinkDB All DBs
Position
25
AA seq 342 aa AA seqDB search
MDSTVRSEPQRLQPVQLAVVACGSRLQETLTMIKSAVIFSRSELHFHIFAEEDLHAGFRD
TLQSWPQRVRSRFSYSIYPISFPSENAREWRKLFKPCASQRLFLPLILKQVDSVLYVDTD
ILFLRPVEDIWSFLSSFNRSHVAALAPEHEEPRMGWYNRFARHPYYGKTGVNSGVMLINM
TRIRHTHFKNDLSAMDLSWSDLLMPLLNKYKLNITWGDQDLLNIIFHYNPESLLVFPCHW
NYRPDHCIYGSNCAAAEQHGIYILHGNRGVYHDDKQPAFSAVYNAIQQYAFEDDLLHGLL
DPLEEKLKSSEHTYCGRVRHIFTKRLRETIRDLQEQSAPPEV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggactccactgttaggtctgagccgcagcgtctgcagccggtgcagttggccgtggtg
gcgtgcggatccagactgcaggagactctcaccatgatcaaatccgccgtcatcttcagc
cgcagtgaactgcacttccacatcttcgctgaggaggatctgcatgctggattcagagac
acgctgcagtcatggccgcagagggttcgctccaggttcagctacagcatttatcccatt
agcttcccatcagagaacgccagagagtggaggaaactcttcaaaccctgcgcttcacag
agactcttcctgcctctgatcctgaagcaggtggactcagtgctgtatgtggacactgat
atcctcttcctgcggccggtggaggacatctggagcttcctgtcctcgttcaaccgcagt
cacgtggcggcgctggcacctgaacacgaggagcctcgcatgggctggtacaaccgcttc
gctcgacacccatactacggtaaaactggagtcaactcaggagtgatgctgatcaacatg
acgcgcatcagacacacacacttcaagaatgatctgtcagcgatggacctgagctggtct
gatctcctgatgccgctgctgaacaaatataagctgaacatcacctggggggaccaggac
ctgctcaacatcatcttccactacaaccccgagagtctgcttgtgttcccctgccactgg
aactatcggccggatcactgtatttatggcagtaactgcgccgccgctgaacaacacggc
atctacatcctacacggcaatcgaggcgtttaccacgatgacaagcagccagcattcagc
gccgtttataacgccatccagcagtatgcgtttgaggatgatctcctccacggtttgctt
gatcctctggaggagaagctgaagagttctgaacacacgtattgtggacgggttcgacac
atcttcaccaaacgcctgagagaaaccatcagggacctgcaggaacagagcgcaccgccg
gaggtttga

KEGG   Danio rerio (zebrafish): 556315Help
Entry
556315            CDS       T01004                                 

Gene name
gxylt1b
Definition
(RefSeq) glucoside xylosyltransferase 1 precursor
  KO
K13676  UDP-xylose:glucoside alpha-1,3-xylosyltransferase [EC:2.4.2.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    556315 (gxylt1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    556315 (gxylt1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     556315 (gxylt1b)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  O-Glycan
   556315 (gxylt1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_8 HD_6
Motif
Other DBs
NCBI-GeneID: 556315
NCBI-ProteinID: NP_001025270
ZFIN: ZDB-GENE-041210-116
Ensembl: ENSDARG00000022550
Vega: OTTDARG00000035973
UniProt: Q5SP46 B3DK90
LinkDB All DBs
Position
4
AA seq 405 aa AA seqDB search
MRIYLRTFGLCIVVALLSLVFLFSKHDEGSFSAGFKQVRAPLQQKSFNGAKAKQRPTATT
SHRDVVQNPNSPVQEEVLMHLAAVACGERHGEVVNMLKTAVTLSQRALRFHIFAEQQLQT
SIKADLDSWPAFIQGKFSYVLHPISFPHEHHEEWSQLFKPCASQRLFLPMILRELDSLLY
VDTDVLFLQPVELIWDMLMLFNSTQLIAMAPEHEEPRIAWYSRFSWHPYYGKMGINSGVM
LMNLTRMRITQFKNDMTPVGLHWDELLMPLLQKYKLNITWGDQDLINIIFHYNPEMVYTL
PCHWNYRPDHCIYGSNCAPAEDEGVFVLHGNRGVFHSDKQPAFRAVYEAFEQYTFGEDLR
QSLLSRLEVALNETTHTYCGKASHFFTTGLQKSVRRLQRATPPGD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatatatcttaggacatttggtttgtgcatagttgtcgctcttttatctttggta
tttctgttcagtaaacatgacgaaggaagtttttcagctggatttaagcaagttcgagcg
ccgctgcaacagaagagcttcaatggagcaaaagcaaaacaacgacccaccgcgaccaca
tcacaccgagatgttgtccagaatccgaactcacctgtccaggaggaggtactgatgcat
ctggcagcggtggcctgtggagagagacacggagaagtggtcaacatgctgaagactgca
gtcacgctcagccaaagagccttgagatttcacatctttgcagagcaacagttacaaacc
agcattaaagcagatctggattcctggccggctttcatccaagggaaattcagctatgtt
cttcaccccatttcattcccccatgagcaccatgaagagtggagtcagcttttcaaaccg
tgtgcttcacagagactcttcctgcccatgattctgagggaactggactccttgctgtat
gtggacacagatgtgctcttcctgcagcctgtagagctgatctgggacatgctgatgctc
tttaactccacacagttaatagcaatggctccagaacacgaggagcccagaatcgcctgg
tacagtcgcttctcctggcatccctattatgggaaaatgggcatcaactctggcgtcatg
ctgatgaacttgacccggatgcgaatcacacaattcaagaatgacatgacccctgttggt
ctacattgggatgagctcctgatgcctttattacaaaaatacaagcttaacatcacctgg
ggtgaccaagacctcattaacatcatcttccattacaatccagaaatggtatatacattg
ccctgccactggaactaccgtcccgatcactgcatctatggcagcaactgcgctcctgct
gaagacgagggtgttttcgtgcttcacggaaacagaggagtgtttcacagcgacaaacag
cctgccttcagagccgtgtatgaggctttcgaacagtacacatttggcgaggatctcaga
cagtcactgctgtcacggctggaagtggcgctgaatgaaacgacacacacatactgtggt
aaagcgagtcatttcttcaccacgggactccaaaagtctgtcaggaggctccagagagcg
actccaccaggtgactga

KEGG   Danio rerio (zebrafish): 567541Help
Entry
567541            CDS       T01004                                 

Gene name
gxylt2
Definition
(RefSeq) glucoside xylosyltransferase 2 precursor
  KO
K13676  UDP-xylose:glucoside alpha-1,3-xylosyltransferase [EC:2.4.2.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    567541 (gxylt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    567541 (gxylt2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     567541 (gxylt2)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  O-Glycan
   567541 (gxylt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_8
Motif
Other DBs
NCBI-GeneID: 567541
NCBI-ProteinID: NP_001103670
ZFIN: ZDB-GENE-070424-64
Ensembl: ENSDARG00000044191
Vega: OTTDARG00000038395
UniProt: A4QN62
LinkDB All DBs
Position
6
AA seq 441 aa AA seqDB search
MRIHCKVVAIAVCFGVFLLLYFFGGNAADEPPLKEVAKEKHFPSFGNFEDIVLLKGAKQT
NEEPQKPPKLIRKEPKLSSRRAENVIAKTRLKSEVGRPRSKVTLAEDVMHLAVVACGNRL
DETLNMVKSALLFSMKKIKFHIFAEEDLAEQFERGFSQWPQTLSSRFHYSIYPITFSVGN
ADEWKKLFKPCAAQRLFLPVILKDVDSLLYVDTDVLFLRPMDDIWKFLKAFNSTQLAAMA
PEHEIPKIGWYSRFARHPYYGVTGVNSGVMLMNLTRIRNTLFRNSMIASGLSWENLLHPL
YQKYKNHITWGDQDLLNIIFHYNPECLYIFPCQWNYRPDHCMYGSNCKAAEEEGVSILHG
NRGVYHDDKQPAFRVVYDAIHEYPFEENLFQSLFYPLQTKFLDTVNTLCGRIPQVFLKQI
EKSMKAAYEKKVVRRVRPPHK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaggattcactgcaaggttgtggccatcgcggtgtgcttcggagtttttctacttttg
tactttttcggggggaacgctgcggacgagccgccgctgaaagaagttgcgaaagaaaaa
cattttccatcattcggtaatttcgaggacattgtccttctgaaaggtgcgaaacaaacc
aacgaggagccacagaaaccaccgaaactaatccgtaaagagcccaagttgagcagcagg
agagcagagaatgtcatcgcgaagactcggcttaaaagtgaggtggggcgccccaggtca
aaggtcacactggcagaggatgtcatgcacctggcagtggtggcttgtgggaaccgtcta
gatgaaacgctcaacatggtgaagtcagcgctgctgttcagcatgaagaagatcaaattt
cacatctttgcagaggaagacttggctgaacaatttgaaagagggttcagtcagtggcct
cagacgctgtcctccaggtttcactacagcatatatccaatcaccttctctgtggggaat
gcagacgaatggaagaaactcttcaagccgtgtgccgcccagaggctatttcttcctgtt
atcttgaaggatgtggactctctgttatacgtggacacagatgtgctgtttctccggcct
atggatgacatctggaagtttctgaaagcgttcaacagcactcagttagctgctatggcc
ccagagcatgagatccccaagatcggctggtatagtcgcttcgccagacacccctattat
ggagtcacaggggtcaattcaggggtcatgctaatgaacctcacaaggattcgtaacact
ttgttcaggaacagtatgatcgccagcggtctgtcatgggaaaatctgcttcaccctctc
tatcagaaatacaagaaccacatcacatggggagaccaagacctcctcaacatcatcttt
cactacaacccagaatgtctgtacatattcccttgccagtggaactatagacccgatcac
tgcatgtatggaagcaactgtaaggctgcggaggaggagggggtttctattttacatggc
aaccgaggggtttatcatgatgacaagcagcccgccttcagggtggtgtatgatgccata
catgagtatccctttgaggagaacttgttccagtctttgttttaccctcttcagactaag
ttcctagacacggttaacaccttgtgtggaagaataccacaggtgttcctcaaacagatt
gagaagagcatgaaggcggcatatgagaaaaaagtggtgcgccgtgtccgaccgccacac
aagtaa

DBGET integrated database retrieval system