KEGG   Danio rerio (zebrafish): 100333762Help
Entry
100333762         CDS       T01004                                 

Gene name
zmp:0000000760
Definition
(RefSeq) collagen alpha-1(XXII) chain-like
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Laminin_G_3 Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 100333762
NCBI-ProteinID: XP_002664125
ZFIN: ZDB-GENE-130530-763
Ensembl: ENSDARG00000074745
UniProt: E7EXE7
LinkDB All DBs
Position
13
AA seq 780 aa AA seqDB search
MLVLSVLLAVFGLIICQELPTYDLLEEFRLSESSGVRRVSGSEPEAVAYRVNPSLHLKKS
TSDIYPDGLPSDYSVIATFKVTKDTAKTSWNLWQVSDPEGRDQVGLRFQGDTLTLDFFYT
NPKGTQMLRTFQRVEKLFDGEWHKLALSVKGEQVKLFIDCEEISVEPLDEPRPVIRQGFT
SIVKRAVGDRSVSVDLQKMEVSCDADQAYSESCCELSSVCGGYAEIGLTAGRGKATCKCM
HGQPGVQGSPGPKGHRGLPGNTGDPGRQGNWGRRGNTGDYGHIGETGPKGEQGIKGEKGM
RGLRGREGDRGPKGLKGLKGASGHKGVRGSPGERGETGQLGEVGAAGERGYEGIAGYQGV
KGSEGLHGAEGSRGPRGHQGIVGDPGERGTPGEKGKPGNQGLKGRVGGVGGKGIVGDPGL
PGRDGDPGVEAYQGPQGPEGKRGQIGDRGEKGEQGPPGNMGPPGLTGSQGYKGSAGKPGR
PGFIGPPGRTGHIGIPGKPGPKGDTGITGVLGSKGQKGEKGVKGPKGRIGDGGVPGQQGS
RGKRGPVGEQGRKGRGGSKGVRGDGGPVGFQGPPGPPGPTFPAQHVIEVCKRVVLEQMST
FANSVKRTCAAVCPLYGDVSMGAPGPPGPKGPPGPPGDPGIDGLKGELGQQGFYGEPGDQ
GRQGSAGDRGETGDKGAKGYGLPGHIGEQGPQGQRGRPGRAFDGQPGQMGERGHVGQPGL
RGHPGLPGVPGVCLTSGCALLNATLSRPPQQVPEQAPQRASQRAPQRGSQRGSQRFRGRQ
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgctggttctctctgtcctcctggctgtcttcggcctcatcatttgtcaggaattgcca
acttatgacctgctggaggagttccgcttgtccgagtcttcaggggtgagacgggtcagc
gggtccgagcctgaagctgtggcgtatcgtgttaacccgtccctccacctcaagaagagc
acaagtgacatctacccagacggtctaccatcagactactctgtcatcgccacctttaaa
gtgaccaaggacactgctaaaacatcctggaatctatggcaagtcagtgaccctgaaggc
cgagatcaggtcggccttcgctttcagggcgacactctaaccctggacttcttctacacc
aacccgaagggcacacagatgctgcggaccttccagagagtagaaaaactctttgatgga
gagtggcacaagttggcattgagtgtaaaaggcgaacaagtgaagctatttattgactgt
gaggagatcagtgttgagcctctggatgagccacggccggtgatccgacaaggttttacg
tccatcgtaaagagagccgtaggtgatcgctctgtctcggtggatctgcagaagatggaa
gtgtcctgtgatgctgatcaagcgtactctgagagctgctgtgaactctccagtgtgtgt
ggaggatatgctgagatcggtttaactgcaggacgaggaaaagccacctgtaaatgcatg
catggacaaccaggtgtccagggatccccaggacccaagggtcacagaggtctgccgggg
aatacaggagatccaggccgacagggcaactggggccgacgtgggaacactggagattat
gggcacataggagaaactgggcctaaaggcgagcaaggcatcaaaggtgaaaagggcatg
agaggacttcgaggccgggagggggataggggacccaaaggcctgaaaggcctaaaagga
gcttcaggtcacaagggagtgcgagggtcacctggagagaggggtgaaaccggacagctg
ggggaagttggtgcagcaggagaacggggatatgaggggattgcgggatatcagggagtg
aagggaagcgaaggcttacacggagctgaaggatctcgaggaccacgaggccaccagggg
attgtgggagatcccggtgagcgaggaacacctggagaaaagggaaagcctggtaatcaa
ggcctaaaaggaagagttggtggagtagggggaaagggtatagttggtgatccaggtttg
ccagggcgagatggagatcctggagttgaggcttatcaaggaccacagggacctgaaggg
aagcgaggacaaattggcgacaggggtgaaaaaggtgaacaaggtcctccaggaaacatg
ggccctcctggactcacgggttcgcaaggttacaagggctctgctggaaagccaggaaga
ccaggatttatcgggcctcctggaagaacgggccacattggaatacctggcaaaccaggc
cccaagggtgacactggcattacaggagtcctgggaagcaaagggcagaagggtgaaaag
ggagtcaaaggacctaagggcaggataggagacggtggtgtgccagggcaacagggaagc
cgaggaaagcgagggccagttggagagcagggtagaaaaggtcgcggaggctccaaggga
gtgagaggagatggtggcccagtgggctttcaagggcccccaggcccaccaggccccact
ttccccgctcaacatgttatcgaggtctgcaagcgtgtggtcctggagcagatgtccaca
ttcgccaactctgtgaaaagaacatgtgcagccgtgtgcccactctatggagatgtgtca
atgggcgccccaggtcccccaggaccgaaagggccacctggaccaccaggcgatcctggc
atcgatgggcttaaaggagaacttgggcagcagggattttatggagaacccggtgaccag
ggcagacaaggctcagcaggtgacagaggagaaacaggagacaagggagctaaaggctac
ggccttcctgggcacatcggggagcaggggccacagggtcagcgtggccgaccaggccga
gcttttgatgggcaaccaggtcagatgggtgagagaggacatgttggccagcctggatta
cggggacaccctggactaccaggagttcctggagtctgtctgacgtctggatgcgccttg
cttaatgctactttaagcagacctccacaacaagtgcccgagcaggcgccgcaacgagca
tcccaacgggcacctcaacggggatctcaacgaggatctcagaggtttagaggacgccag
tga

DBGET integrated database retrieval system