KEGG   Danio rerio (zebrafish): 100334953
Entry
100334953         CDS       T01004                                 

Gene name
nck1b
Definition
(RefSeq) cytoplasmic protein NCK1 isoform X1
  KO
K07365  NCK adaptor protein 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100334953 (nck1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    100334953 (nck1b)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100334953 (nck1b)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 100334953
NCBI-ProteinID: XP_002666641
ZFIN: ZDB-GENE-090317-1
Ensembl: ENSDARG00000075369
Vega: OTTDARG00000031727
UniProt: E7F6M0
LinkDB
Position
24
AA seq 381 aa
MTEEVIVIAKFDYMAQQDQELDIKKNERLWLLDDSKSWWRVRNATNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKTGMRETASNADSDFYPDNGERLYDLNLPALVKFSYAA
EREDELSLVKGTRVIVMEKCSDGWWRGSYNGRSGWFPSNYVTEDADGSASNDSAGLSDKL
SAVVQSANGNRVLHTVQALYPFSSGNDEELNFEKGEVMDVVEKPENDPEWWKCRKSDGQM
GLVPKNYVTVLQESHNSASMPGPPTPDCDYIEPSSSGRFAGKQWYYGKVTRHQAEVALNQ
RGSEGDFLIRDSESSPNDFSISLKAQSKNKHFKVQLKDNLYCIGQRKFNTMEELVEHYKK
APIFTSEQGDKLYLVKALAAS
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgacggaagaggtgattgtcatcgccaagtttgattacatggcccagcaggaccaggag
ctggacatcaagaagaacgagcgtctgtggctcttggatgactccaagtcctggtggcgt
gtgagaaacgccaccaacaagacgggcttcgtcccatccaactacgtcgaacggaagaac
agtgccaggaaagcctcaatcgtcaagaacctcaaggacacattagggattggaaaggtg
aaaaggaaaacaggcatgcgtgaaacagcgtccaatgcagactctgatttctacccagac
aacggtgaacgtctgtatgaccttaacctccctgcgctggtcaagttcagctatgcggcc
gagcgggaagatgagttatcgttggttaaaggaacgagggttatcgtgatggagaagtgc
agtgatggctggtggaggggaagctacaacggccgttcgggatggttcccttccaactac
gtgacagaggacgcagatggatcagcgagcaatgattctgctggactttcagacaaactg
tctgctgttgttcaaagtgcgaatggcaaccgtgtgctgcacacagtacaagcactctac
ccgttcagctcgggtaacgatgaagagctgaactttgagaagggggaggttatggatgta
gtggagaagccagaaaatgacccagagtggtggaagtgtcgtaagtcagatgggcagatg
ggacttgttccgaagaactacgtgactgttctgcaggagtcgcacaactcggccagcatg
ccggggccacccacacctgactgtgactacattgagccttcatccagcggccgcttcgca
ggaaagcagtggtactacgggaaggtgacacgccaccaagcagaggtggcgcttaaccag
aggggctcagagggagacttcctcatccgggacagcgagtcctcgcccaatgacttttca
atatcgctgaaagctcagtccaaaaacaagcattttaaagtccagctgaaggacaacctg
tactgcatcggacagcgcaagtttaacacaatggaggagttggtggaacactacaaaaag
gcgcccatcttcaccagtgagcagggcgacaaactctacctggtcaaggctctggctgcc
tcctga

KEGG   Danio rerio (zebrafish): 393972
Entry
393972            CDS       T01004                                 

Gene name
nck2a
Definition
(RefSeq) cytoplasmic protein NCK2a
  KO
K19862  NCK adaptor protein 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    393972 (nck2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    393972 (nck2a)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   393972 (nck2a)
SSDB
Motif
Pfam: SH3_9 SH3_1 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 393972
NCBI-ProteinID: NP_957291
ZFIN: ZDB-GENE-040426-686
Ensembl: ENSDARG00000018206
UniProt: Q803A2
LinkDB
Position
9
AA seq 403 aa
MTEEVIVIAKWDYTAQQDQELDIRKNERLWLLDDSKTWWRVRNASNRTGYVPSNYVERKN
SLKKTSLVKNLKDTLGLGKTKRKTSARDPSPTPSTEAEYPSNGSAGGGGGGGAERIYDLN
IPALVKFSYAAERDDELNLVKGERVVVMEKCSDGWWRGSHAGRVGWFPSNYVQEEVGYTD
NDGVFGDTVGGFRSLKVGQGAAMANGRPGGSGSSVLHVVQTLYPFSSVTEEELNFEKGET
MEVLEKPENDPEWWRCKNSRGIVGLVPKNYVVVLDDGPVAKSLGSSHGSPHISHTVPSRV
GKFAGKGWYYGNVTRHHAECALNERGVEGDFLIRDSESSPSDFSISLKAVGKNKHFKVQH
QDGAYCIGQRRFSSMDELVEHYKKAPIFTSEQGDKLYLVKALG
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgacagaggaggtgattgttatagccaagtgggactacacagctcagcaagaccaggaa
ctggacatccggaagaacgagcggctctggttactggatgattccaaaacctggtggaga
gtgcgtaacgcatccaaccgcaccggctacgtcccctctaattacgtggagcgcaagaac
agtctgaagaaaacctcactagtgaagaacctgaaggacactctcggactgggcaaaacg
aaaaggaagaccagtgctcgtgatccatctcccacacccagcacagaagcagaatatcca
tccaatggcagcgcaggaggaggcggagggggcggagctgaacgaatttatgacttgaac
attccagcattggtgaagttctcttacgcagccgagcgggacgatgaactcaacctcgtc
aaaggggagagggtggtcgtcatggagaagtgcagcgatggctggtggaggggtagccat
gctggccgtgtcggctggttcccgtctaactacgtccaagaggaggtgggatacacggac
aacgatggggtgttcggggacaccgtgggggggttccggtcgttgaaggtggggcaaggt
gcagcaatggccaacggccggccggggggctctgggagctccgttctgcatgtggttcag
actctgtaccccttcagctcagtcacagaggaggaactaaactttgagaagggtgagact
atggaggttttggaaaagcccgagaatgacccggagtggtggaggtgtaaaaacagccgc
ggaatagtaggccttgtgcctaagaactatgtggtagtgctcgatgacgggccggtagca
aagagcttagggtcaagtcatggatcccctcacatcagtcacacagtgccctcgcgtgta
ggaaaatttgctggaaagggctggtactatggtaatgtgacacggcaccatgcagagtgt
gcgcttaatgagagaggagtggaaggagacttcctcatacgggacagtgagtcgtcgccc
agtgacttctccatttctctgaaagctgtgggaaagaacaagcacttcaaggtgcagcat
caggacggagcgtactgcatcggtcagcggcgtttcagcagtatggatgagcttgtagag
cactacaagaaagcgcccatctttaccagtgaacaaggagacaaactctaccttgtcaag
gcccttggctaa

KEGG   Danio rerio (zebrafish): 445098
Entry
445098            CDS       T01004                                 

Gene name
nck2b
Definition
(RefSeq) cytoplasmic protein NCK2b
  KO
K19862  NCK adaptor protein 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    445098 (nck2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    445098 (nck2b)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   445098 (nck2b)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 hSH3 SH2_2
Other DBs
NCBI-GeneID: 445098
NCBI-ProteinID: NP_001003492
ZFIN: ZDB-GENE-040801-235
Ensembl: ENSDARG00000043361
Vega: OTTDARG00000027280
UniProt: Q4V9A1
LinkDB
Position
6
AA seq 380 aa
MSEEAIVIAKWDYTAQQDQELDIRKNERLWLLDDSKTWWRVRNTSNRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTKRKTSTREASPTPSTDEYSSNGGGAERIYDLNTPAIVKFA
YNAEREDELSLVKGSRVMVMEKCSDGWWRGSYSGQMGWFPSNYVQEEEMEDTSADLPAVF
SSQPGLSNGQSSRVLHSVQTLYPFSSVTEEELNFEKGEIMEVLEKPENDPEWWRCKNCRG
QVGLVPKNYVVVLNDGPLSTASGSHSQQNSHTGPSHTGLFAGKDWYYGSVTRHQAECALN
ERGVEGDFLVRDSESSPSDFSVSLKAVGKNKHFKVQLSNEVYCIGQRRFNSMDELLEHYK
KAPIFTSEHGEKLYLIKPLQ
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtcagaggaggcgattgttattgccaagtgggactatacggcacaacaagaccaggaa
cttgacatcaggaaaaacgagcgtctgtggctcctggatgattcaaaaacatggtggaga
gtacgaaatacgtccaacagaacgggttatgttccttccaattacgttgaacgcaagaac
agtctcaagaaaggatctctggtgaaaaatctcaaagatacactcggcctgggaaaaacg
aagcgtaaaactagcacacgggaagcctctccaacacccagcacagatgagtactcatct
aatggaggaggagccgaacgaatatatgacctgaacactccggccatagtcaagtttgcc
tataatgcagaacgagaggacgagctcagtctggtcaaggggtcccgggtgatggtgatg
gaaaaatgcagtgacggctggtggaggggcagctatagtggtcagatgggctggttcccc
tccaactacgtccaggaggaggagatggaggacacgtcggctgaccttccagctgtcttc
tcctcacagccgggcctcagtaatggccagagctccagagtgcttcacagtgttcagacg
ctttaccctttcagctccgtcacggaggaggagctgaactttgagaagggcgagataatg
gaggtactggagaaaccagagaacgacccagagtggtggaggtgtaagaactgccgtggg
caggtgggtctggtgccaaagaactatgtggttgtgctcaacgatggtccattatcgaca
gcctcaggctcacattcccagcagaacagccacacgggaccatcccacacagggctgttc
gccggaaaagactggtactatgggagcgtgacacgacaccaggctgagtgtgcgctgaat
gagagaggggtggagggagacttcctcgtgcgggacagcgagtcctctccgagtgatttc
tcagtgtctctgaaagcagtcgggaagaacaaacacttcaaggtgcagttatccaacgaa
gtttactgtatcggtcagcggcgcttcaacagtatggatgaactcttagagcactacaag
aaagctcccatctttaccagcgaacatggcgagaagctttaccttatcaaacccctccag
tga

KEGG   Danio rerio (zebrafish): 564584
Entry
564584            CDS       T01004                                 

Gene name
nck1a
Definition
(RefSeq) cytoplasmic protein NCK1
  KO
K07365  NCK adaptor protein 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    564584 (nck1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    564584 (nck1a)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   564584 (nck1a)
SSDB
Motif
Pfam: SH3_9 SH3_1 SH2 SH3_2 SH3_3
Other DBs
NCBI-GeneID: 564584
NCBI-ProteinID: XP_693006
ZFIN: ZDB-GENE-070912-547
Ensembl: ENSDARG00000074262
Vega: OTTDARG00000024484
LinkDB
Position
2
AA seq 310 aa
MEMANLFKHFFRIGKVKQKGCVRDLPSSAEKYEGDERLYDLNLPALVKFNYTAEREDELS
LVKGTRVIVMEKCSDGWWRGSYNGLSGWFPSNYVTEDVDGTMRVDSVNPDKLASVGHNNN
SSQVLQTVQALYHFSSGNVEELNFNKYELMDVLEKPENDPEWWKCRKENGQVGLVPKNYV
TVVQKTHKELGISGPHPSNYDIKPSMDGKFGGKQWYYGKLTRHQAEMVLNQRGVDGDFLI
RDSESMPNDFSISLKALYKNKHFKVLLNDGFFCIGQRKFSTMEDLVEHYKKAPIFTSEHG
DKLYLIKPLT
NT seq 933 nt   +upstreamnt  +downstreamnt
atggagatggccaacctttttaaacacttctttcgaattgggaaagtgaagcagaaaggc
tgtgtacgagatttgccctccagtgcagagaaatatgagggcgatgagcgactttatgac
ctcaatcttcctgcgctggtcaagttcaactacaccgcagaacgagaggatgagctctct
ctggtcaagggcacaagggtcatcgtaatggagaagtgcagcgacggctggtggagagga
tcctataatggcctttctggatggttcccctctaattatgtcacagaggacgtggacggg
acaatgagggtcgattccgtgaaccccgataaactggcctccgtggggcacaataacaac
agctctcaggttctgcagactgtacaggcactttatcatttcagctctggcaatgtcgag
gagcttaatttcaacaagtacgaactcatggatgtgttggagaaacccgagaacgatcct
gagtggtggaagtgtagaaaggaaaatgggcaagtgggtttggtgcccaagaactatgtg
acggttgtgcagaaaacacataaggaattgggcatttcagggcctcatccttcaaactat
gacattaagccctctatggatggaaagtttggaggaaaacaatggtactatggaaaactg
acacggcaccaggctgagatggtcttgaaccagagaggtgtagatggagatttccttatc
agagacagcgagtctatgccaaacgacttctccatctctctcaaggcattgtacaagaac
aagcatttcaaggtgctgctaaatgatggattcttctgcattggtcagcgcaagttcagc
accatggaggatctggtggaacattacaaaaaggcccccatatttaccagtgagcatgga
gataaactgtacctgataaaaccattaacctga

DBGET integrated database retrieval system