KEGG   Danio rerio (zebrafish): 100535494
Entry
100535494         CDS       T01004                                 

Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform isoform X1
  KO
K05457  neuregulin 3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100535494
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    100535494
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   100535494
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 100535494
NCBI-ProteinID: XP_017214452
LinkDB
Position
13
AA seq 670 aa
MSDSSGTLNNSGAMVLEEPDGRGGSGGREQAQAPARGGILRCGTCALWPRQQTWLCVVPL
LIGFIGLGLSLMLLKWIVVGSVRDYVPTDLVDAKGIGQDPIFLSKPSTVPKGSDTTTTTT
IIGGVSSVSPTVTTVVRSRTRTGTPPNIPPRGGGASGSQVTQKSPSTRFVTRNPTFTTTV
ASTTTSTVHTSTSSPSPSNPAVLNDSTQMWTREHSSTERHVTTPGRTHVSRKTPSPTLPP
LKSEHFKPCQEKDLAYCLNDGECFVIETLSGPHKHCRCKEGFQGIRCDQFLPKTDSILSD
PMDHLGIEFMESKEVYKRQVMSITCIAMGISFLGTLCMALYCRNKRRREKLQAHLKESRS
LKNYNLNSSSLASKPNLRPQHVLQLQKFYKPTRSTPPHGGAIRELSFAPSNADSTNPQGS
MTGKQLRSSSLSHSPDQRCRSALRPASRRTPPITRGCLNAIGGSRDSGPAYQHLQEVDSS
ERESVRRNISGPGNDLHQDSFYNMQATQSSKSWSSHLDHRCARSLRSGGPSQSPPAPYRP
CSIPIIPSVHSYQDEVSCMQTAPTDGSSRSSPLEGTANTAAVQQQSIRAAGRREEVVSLL
DEAQEQLQTLAHAQRKQEDLSSSVPQGAKETVCILLANGGGQGGVASFGPTETQLVSPRD
THKDATKPGQ
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgagtgacagctcgggaacattgaacaactctggggctatggtactggaggagcccgat
gggagaggtggctccggtggacgtgaacaagcccaggcccctgcgcgtggtgggatttta
aggtgtgggacctgtgctctttggcctcgccaacaaacctggctctgtgtggttccactt
ctcattggcttcataggactggggctcagtctgatgctgctgaaatggattgtagtgggt
tctgtgcgtgactacgtgcctactgacttggtggatgccaaaggtattggtcaggacccc
atttttctgtccaagcctagcactgttcctaaggggtctgacacaactactactactacc
attattggaggggttagctcggttagtcccactgtcaccacagtggtgcggagcaggact
cgaacgggaactcctcccaacattccccctagaggtggaggagcatccggcagccaggtg
actcagaagagcccttctacacgatttgtcactcgtaatcccacctttacgaccaccgtg
gcctctaccaccacgtctactgtccatacatccacctccagcccctctccctccaatcca
gcggttctcaacgactccacccaaatgtggaccagggagcactcatccactgagaggcac
gtgaccacacctggtcgaacccacgtcagccgcaaaacaccatcgccaaccctgccacca
ttgaaatcggagcacttcaagccgtgtcaggagaaggatctggcctactgcctgaatgat
ggcgagtgctttgtcatcgagaccctgagcggcccacacaaacactgcaggtgtaaagag
ggtttccagggcattcgctgtgaccagttcctgcccaagactgactccatcctctcagac
ccaatggatcacttgggcattgagttcatggagagtaaggaggtgtacaaaagacaagtg
atgtctatcacatgtattgccatggggatcagctttctaggcaccctctgcatggctctc
tactgccggaacaagagaaggagggaaaagctccaggcacatttgaaggagagtcgaagc
ctgaaaaactacaacctcaactcttccagcttggccagtaaacccaatcttaggcctcag
catgtcctgcagctccagaaattttataaacccacaaggtccacgccaccacatggaggt
gccattcgagagctcagttttgctccaagtaatgctgactctaccaatccacagggctca
atgacaggaaaacagcttaggagtagctccctctctcatagtcctgatcagaggtgtcgc
tctgctcttcggcctgcctcgcgcagaaccccgcccataaccagaggatgcctgaatgcc
attggtggatccagagactctggccccgcctaccaacatctacaggaagtagacagttca
gagagggagtcagtgagaaggaacatctctggcccaggtaatgacctgcatcaggattca
ttttataatatgcaagccacgcaatcctcaaaatcttggagcagccacttagaccacagg
tgtgctaggagtctccggtcaggcggtccaagccaaagtcctcctgctccataccgaccc
tgctcaatcccaatcattccctctgtccactcctaccaggatgaggtctcatgtatgcaa
accgcccccactgatggaagcagtcgctctagtcctcttgagggaacagcgaatactgca
gctgtccaacaacagtccatccgagcggctggtagacgggaagaagtggtttcgctactg
gatgaggctcaggagcagcttcaaacgctggcacatgcccagaggaaacaggaggacctt
agtagctccgtccctcagggggccaaagagactgtgtgcatccttttagcaaatgggggt
ggacaagggggagtggcctcttttgggccaacggagactcagttggtgagcccaagagac
acacacaaagatgctacaaagcccggccaatga

KEGG   Danio rerio (zebrafish): 101882495
Entry
101882495         CDS       T01004                                 

Gene name
nrg3b
Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform isoform X1
  KO
K05457  neuregulin 3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101882495 (nrg3b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dre04052]
    101882495 (nrg3b)
Cytokines and growth factors [BR:dre04052]
 Growth factors
  Growth factors (RTK binding)
   101882495 (nrg3b)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 101882495
NCBI-ProteinID: XP_005156311
ZFIN: ZDB-GENE-130603-38
Ensembl: ENSDARG00000089766
Vega: OTTDARG00000040526
UniProt: E7FCS5
LinkDB
Position
12
AA seq 764 aa
MSERTALGATMETMTLEEPGGEQASPRAPGPLRCGPCAVWPRQQTWLCVVPLLMGFVGLG
LSLMLLKWIVVGSVQDYVPTDLVDANRIGQDPIFLSKPSSLPKGSDASASTTSTTPSAAP
GSATRAAEGTGTVQRTRIGQSSNHTASSSSSSGGGGGGLGGGSGNRAPHLHNRVGTRVTN
ITTTTRATNPAPPGGKEVTPRSTTVRKPNGEGGSRSASPSARAGPPSPTTTSTTTTTITT
STTTTQAAQPTSTPASPSKPGQRWNHGRSSKGPSTKPTRPHHRFRTLAPTTSTVRSEFFK
PCQDSQEMAFCLNEGECFIIETVAGVHRHCRCKEGYRGLRCDQFVPKTDSILSDPTADEL
GIEFMESAETYQRQILSIFSIAMGISLLGVACMALYCKNKRQREKHRAHLTEIRNLRDCT
VNASGLMSKSSPRLESSLQLQKSRRVHGLSSPQAASIVLSSSKVSLPNQNRSFSMGKRCR
SCSFSSSPALKHKVSNYRAVSKWTPPIPRAGHHLSGGSRDSLHSYKHLQEVEVNDVMPQA
LRRCQSHLDSNQQNRCNLNMQIMLSAHSKGKMSYTDVPCTRLDQGMTFPPPSFRAHSVPI
IPSVQGPDFGGGGGNKLHNVGMGSSSYNPINPETESVANSSRSLASSSATVQEPQTLTCS
ESALMSRGQIKHKSLVTYTTALGSGTSSRRAKTVISMTVLGTGVKTTQYAASLLSKTTAG
REEHSAFEEVKQGDGLQTSFTGDEKDSSFSSGVRGETSLDHPKS
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgagtgagagaacagcactaggggccaccatggagaccatgaccctggaggagcccggg
ggtgaacaagcctctccccgggccccagggcccctccgctgtggcccctgtgcagtctgg
ccacgccagcagacctggctttgtgttgtgcccttgctgatgggctttgtgggcctgggc
ctcagcctgatgcttctaaaatggattgtggtgggctcagtgcaggattacgtcccaact
gatctggtggacgccaatcgcattggacaggacccgattttcctatctaaacccagttcc
ctgcctaagggttctgatgcttcagcatctaccacttccaccactccctcagcagctcca
ggttctgcaactcgagcagctgagggcacaggtacagtgcaaagaactcgaattgggcag
tcctcaaaccacacggccagtagcagtagcagcagtggaggtggcggtggggggttaggg
ggaggctcaggaaacagagctccacacctgcataacagagtgggaacgcgagtgaccaac
atcacaaccacaacccgggccaccaatcctgctccaccaggaggaaaggaggttactcca
cgcagcaccactgtccgaaagcccaacggtgagggcgggagtcgaagcgcatcaccttct
gcacgagctgggccaccgagtccgaccaccactagcacgacaaccactacgattacaacg
agcactaccaccacccaagctgcccaaccgacctctacccctgcatcgccctccaagcct
ggtcaacgctggaaccatgggcgctcctccaaggggccttccaccaaacctactcgccca
caccatcgcttcaggacacttgctcccacaacctccacggtgcgttcggagttcttcaag
ccctgccaggacagtcaggagatggccttctgtttgaatgagggcgagtgcttcatcatt
gaaactgtggcaggggtgcacagacactgcaggtgtaaagaaggttaccgtggacttcgt
tgtgaccagtttgtcccgaagactgactccatcctatctgacccaacggcagatgagctg
ggcattgagtttatggagagtgcagaaacttatcagaggcagattctgtccatcttcagc
atagccatggggatcagcctgctgggagtcgcttgcatggcgctttactgcaagaacaag
agacaaagagagaagcatcgagcgcatctgaccgaaattcgcaacttgagggactgtact
gtcaacgcctctggtctcatgtctaaatcaagccccagactcgagagcagcctccagctt
caaaagagcagaagagtccacggtctctcctctccgcaggcggccagcatagttctcagc
agctctaaagtctccctaccaaatcaaaatcgcagtttctccatggggaagcgctgcaga
agctgctcgttctcctcgagccccgctctgaaacacaaggtatccaattatcgagctgtc
tcaaagtggactccccccatccctagagcaggccatcatctcagtggaggatctcgagat
tctctacattcttataaacatcttcaggaggtggaggtcaatgatgtaatgccacaagct
ttgagaaggtgccagtctcacttggacagcaatcaacaaaaccgttgcaatttgaatatg
caaattatgctctccgcccattccaaagggaagatgagctacactgatgttccgtgcact
cgtctcgaccagggaatgacctttcctcccccttctttccgagcccactctgtacccata
atcccttccgtccagggaccagattttgggggcggaggcgggaacaagctgcataatgtg
ggtatgggatcttccagctacaacccaatcaatcctgagactgagtcagtggcaaattcc
agccgatcacttgccagctcctctgcaaccgtgcaggagccacagacactcacctgctcc
gaatcggcactgatgtcaaggggccaaatcaaacacaaaagccttgttacctacacaacg
gccttgggatcaggcacaagctcgaggagagctaagactgtcatttcaatgactgtgctg
ggaacaggggtgaaaaccacgcagtacgccgccagcctgctgtctaagactaccgcagga
cgggaggagcattccgcttttgaggaagtaaagcaaggtgatggtttacaaacttcattc
acgggggacgaaaaagacagctcattttccagtggggtaagaggcgagacttccctcgac
catcccaagagctga

DBGET integrated database retrieval system