KEGG   Danio rerio (zebrafish): 100535692Help
Entry
100535692         CDS       T01004                                 

Gene name
galnt8b.2
Definition
(RefSeq) probable polypeptide N-acetylgalactosaminyltransferase 8 isoform X2
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00512  Mucin type O-glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100535692 (galnt8b.2)
   00514 Other types of O-glycan biosynthesis
    100535692 (galnt8b.2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    100535692 (galnt8b.2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100535692 (galnt8b.2)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  Mucin-type
   100535692 (galnt8b.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100535692
NCBI-ProteinID: XP_003198272
ZFIN: ZDB-GENE-041210-84
Ensembl: ENSDARG00000095324
Vega: OTTDARG00000007593
UniProt: F1R913
LinkDB All DBs
Position
4
AA seq 595 aa AA seqDB search
MRISFAKSLFPVLSVAVVFLYLSSVKWEIKTQEEKLQRVQQNLSLHSSLLLHKLDKLEAH
LIAVEETRLNVKNEKKPAKKLFPDSYLFKRWSVELSEDEQRKAEDLFQKYGYNAFLSDRL
PLDRELPDTRDHRCAEREYPPDLPTVSVVLIYLDEALSVIQRAVYSIINRTPAHLLKEII
LVDDHSTNEDLQTQLHVYISSINEKHPGLVKMVTHAEQKGLSQARISGWKAASGDVVAIL
DAHIEVHVKWAEPLLARIQADRTLVLSPVFDKINYDDLEVTKYIASAHGFDWALWCMYVT
FPEKWYNQNDPSLPGKSPSVMGILVVDRLFFGEIGTLDEGMQVYGGENVELGIRVWLCGG
SIEVVPCSKIAHIERAHKPYMPDLSNVMKRNALRVAEVWMDEYKKNVYMAWGLPMQNHGI
DIGDLSERKKLRERLNCKRFKWYLENVYNLLNPMDDLLGYGSLINDLQTSLCLDKGPSEE
NTPILYPCHFLISQQFFYTTSGEILVGPLQPLLHSRNRCLADPGSGRFPEFSWCSDTEKP
KHMYWDFKQGQAIQNRDTKRCLEISTKQTGDYKNNVFIQQCRNQHWRIQHAIRDF
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaggataagctttgcaaagagtttgtttccagttttgtctgtcgctgtggtttttctc
tatttgagctctgtgaaatgggagataaaaacgcaagaggagaaacttcagcgagtccag
cagaacttgtcactgcacagctctcttctgctccacaagctggacaaactggaggctcat
ttgatcgctgtggaagagacacgcctcaatgtaaaaaatgagaagaaaccagcaaagaaa
ctattcccagattcatacctcttcaagagatggagtgtggagctttcagaggatgagcag
aggaaagctgaggatctctttcagaaatacggatataacgccttcctcagtgaccgactg
cctctggaccgagagctgccggacactcgagaccacagatgcgctgagcgtgaatatcct
cccgatctgcccaccgtcagtgtggtgctgatttatctggacgaggctctgtctgtcatt
cagagagccgtttacagcatcatcaacagaactccagctcatctgctgaaagagatcata
ctggtggacgaccacagcactaacgaggatctgcagacgcagctgcatgtttacatcagc
tccatcaatgagaagcacccaggcctggtgaagatggtgacccatgcagaacagaaaggc
ctctcgcaggccaggatctcaggctggaaggctgccagcggcgacgtggtcgccattctg
gacgcccacattgaggtccatgtcaaatgggcggagcctctacttgcacgcatccaggct
gatcgcacgctagtcttgagtcctgtgtttgataaaattaattatgacgatctggaggtg
actaaatacattgcctctgctcatggttttgactgggctctctggtgtatgtatgtgaca
ttcccggagaagtggtacaatcaaaacgacccttcgctgccaggaaagagtccctctgta
atgggaatactggtggtggatcgtctgttcttcggtgagatcgggactctggatgaaggg
atgcaggtgtacggaggagagaatgttgaattgggaatacgggtgtggctgtgtggaggg
agtatagaggttgtgccctgctccaaaatcgcacacattgaaagagcgcacaaaccctac
atgcccgacctgagtaacgtcatgaagagaaacgccctcagagtggccgaagtttggatg
gacgagtacaagaaaaatgtctacatggcttgggggcttcccatgcagaatcatgggata
gacattggtgacttatcagagagaaagaaactgagagagaggctgaactgcaaacggttt
aaatggtatctggaaaatgtctataatttgttaaaccccatggatgatttgcttggttat
ggatcgctgattaatgatctgcaaacaagtctatgtttggacaaagggccgtcagaggag
aacactcccattttatatccatgccattttttaatctcacagcaatttttctatacaaca
agtggagagatattagtcggtccccttcagccccttttacacagccgaaaccgctgtcta
gctgatccaggatcgggccggtttccagagttttcctggtgttcagacacagagaaacca
aaacacatgtactgggacttcaaacagggacaggccatacagaacagagacaccaagcgc
tgtctggagatcagcaccaaacagacaggagactataaaaataacgttttcattcagcag
tgcagaaaccaacactggaggatacaacatgcaattcgggacttttaa

DBGET integrated database retrieval system