KEGG   Danio rerio (zebrafish): 100536156Help
Entry
100536156         CDS       T01004                                 

Definition
(RefSeq) venom phosphodiesterase 1-like
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre00240  Pyrimidine metabolism
dre00500  Starch and sucrose metabolism
dre00740  Riboflavin metabolism
dre00760  Nicotinate and nicotinamide metabolism
dre00770  Pantothenate and CoA biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100536156
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100536156
   00240 Pyrimidine metabolism
    100536156
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    100536156
   00760 Nicotinate and nicotinamide metabolism
    100536156
   00770 Pantothenate and CoA biosynthesis
    100536156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dre04090]
    100536156
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dre00537]
    100536156
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     100536156
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     100536156
CD molecules [BR:dre04090]
 Proteins
  100536156
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dre00537]
 Enzymes
  100536156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100536156
NCBI-ProteinID: XP_017207876
LinkDB All DBs
Position
19
AA seq 857 aa AA seqDB search
MDFKNTHKRKVLLLSVGLAVCVLVIILGLALGLGLQLRDCRGKDVSSSCRNRCFEPVGVY
SASCRCDHQCVETQSCCFDYRDVCLLPSELWECTSLRCGEKRLSVSRCHCSEDCMSRGDC
CTNYHSVCKGDTEWVQDECVDLSTPKCPASFKRQPLLLVSLDGLRAEYLQTWGLLVPVLD
KIKRCGTSAPFMQAVFPSKTFPNHYSIATGLYAESHGLVDNNMYDPVFDASFSLSNSEKS
NPRWYQGQPIWNTAMYQGLKAGTFFWPGSDVPINGTFPDLYMDFDGKVPYEQRVFTVLQW
LQLPEDKRPDFFTLYLEEPDSSGHSSGPVSGGLILALQGVDRVIGQLMTGLKQLNLHQCI
NVIIVADHGMEETSCERKEVLQDFIGDVSHLYVNEGPFGRIRAKNKEDTLDAAALVANMS
CKRPQQMIKPYLKHHLPKRFHYANNRRIEDVSVLVNARWLFERYPGSLTFCAGGNHGYDN
DIYSMQASFLGFGPKFLFQTEVEPFSNIELYNLMCDLLEITPFQNNGTHGSMNHLLRRPV
YSPQHPQEQSGPHQCPITSLEPTDTLGCSCTAVNDSVINTRLNLSDAEVADSERRHLLFG
RPRVLQSDVQYCVLNHHGFITAYNTHTHTPIWSSFTMERTAESSPVLSDCLRADVRIPAN
QSATCDLYNNNPNITHAFLFPPNLNVSSEAQFDALTLGNVVPMFPEFKRVWQYLQQVLLV
RLASQYNGLNVLMGPVFDSDSDGRADAPEHIQRLAPLPSHYFVVLLSCVNESQTPAECSG
ELQSVCFLLPHREHNTESCADGQPESQWVEPLLWMHQSRVRDVEWITGLDFFQDSKRPIA
ELLRLKTRPTAAIHPKN
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaagaacacacacaagcgcaaggttcttctgttgtcggtgggcttggctgtg
tgtgtgctggtcattattctaggtctggctctgggtttgggtcttcagctgcgggactgc
aggggtaaagatgtgtcgtcctcctgcaggaatcgctgctttgagccagtaggtgtgtat
tctgcgtcgtgtcgctgtgatcatcagtgtgtggagactcagagctgctgcttcgactat
cgagatgtgtgtctgctgccctctgagctgtgggagtgtacgtctcttcgctgtggtgag
aagcgtctgtccgtcagcaggtgtcactgttctgaagactgtatgagcagaggagactgc
tgcaccaactaccacagcgtctgcaagggagatacagagtgggttcaggatgagtgtgtg
gacttgagtactcccaaatgcccagccagttttaagaggcagccgctgctcttggtttct
ctggacggtttaagagctgaatatctgcagacgtggggcttactggtgccggtgctggac
aagatcaagcgctgtgggacatcagctcccttcatgcaggctgtgttccctagtaagaca
ttccctaaccactactctatagccacgggtctgtatgcggagtctcatggtctggtggat
aataacatgtatgaccctgtgtttgacgcctccttcagtctgtccaacagtgagaagagc
aacccacgctggtaccagggacagccgatctggaacacagccatgtatcagggtctgaag
gccgggacgttcttctggccgggttcagacgtgcccataaacggcacttttccagacctc
tacatggactttgacggtaaggtgccgtatgagcagagggtcttcacggttctccagtgg
ctgcagcttccagaagacaaacggccagatttcttcacgctgtacctggaggagccggac
agctcgggtcacagctctgggccggtcagcggagggctgatcttggctctacagggagtg
gaccgggtcattggtcagctgatgacgggcctcaaacaacttaaccttcatcagtgtatc
aacgtcatcatcgtcgcagaccatggtatggaggagaccagctgtgagcgtaaagaagtt
cttcaggactttattggtgatgtcagtcatctgtatgttaatgagggcccgtttggacga
atcagagccaaaaacaaagaagacaccttggacgcagctgcactagtggcgaacatgtcg
tgtaagcgtccgcagcagatgattaaaccctatctgaagcatcatctgcccaaacgcttc
cattacgccaataacagacgcatcgaggacgtgagtgtgctggtgaacgcacgctggctc
ttcgagaggtatccgggttctctgacattctgtgcaggagggaatcatggatatgataat
gacatctacagcatgcaggcctcgtttctcggttttgggcccaaattcctctttcagacg
gaagtggagccgttttccaacattgagctgtacaacctcatgtgtgatctgctggaaatc
actccgttccaaaacaacgggacccacggcagcatgaaccacctactgaggaggccggtg
tacagcccacagcacccacaggagcagagcggcccgcaccagtgccccatcaccagcctg
gagcccaccgacacactgggctgcagctgcaccgctgtgaatgacagtgtgatcaacaca
cgcttgaacctgagcgatgctgaagtggcagacagcgagcggcggcacttgttgttcggg
cgtccgcgagtccttcagtctgatgtgcaatactgtgtgctgaaccaccacggcttcatc
acggcctacaacacacacacacacacacccatctggagctccttcaccatggagagaacg
gcggagagttctccagtgttgtcagactgtctccgagcagatgtcaggattccagccaat
cagagcgcaacgtgtgacctgtacaacaacaaccccaacatcacacacgccttcctgttc
ccgcccaatctgaacgtgtcgtctgaggctcagtttgacgctctgacgcttggaaatgtg
gtgccgatgttcccagagttcaagagagtgtggcagtatctgcagcaggttctgttggtg
cggttggcgtctcagtataacgggctgaatgtgctgatgggtccagtgttcgactctgat
tcagacggccgcgcagacgctccagagcacatccagaggctggctcctcttccctctcat
tatttcgtggtgttgttgagttgtgtgaacgagtctcagacgccggccgagtgttcaggg
gagctgcagagtgtgtgtttcctgctgccacaccgagagcacaacaccgagagctgcgct
gacggtcagccggagtcgcagtgggtggagcctctgctctggatgcaccaatcacgcgtg
agagacgtggagtggatcaccggattggacttctttcaggacagcaagcgtccaatcgct
gagctgctccgtctgaagacccgccccactgccgccattcacccaaaaaactga

DBGET integrated database retrieval system