KEGG   Danio rerio (zebrafish): 100536197
Entry
100536197         CDS       T01004                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100536197
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100536197
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100536197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100536197
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100536197
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE20 family
   100536197
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Kdo
Other DBs
NCBI-GeneID: 100536197
NCBI-ProteinID: XP_003200338
Ensembl: ENSDARG00000027564
UniProt: E7FE80
LinkDB
Position
17
AA seq 693 aa
MFRKKKKKRPEISAPKNFEHRVHTSFDAKRGVFVGLPTQWQSLIENLRRPKPMVDPSRIT
PVELKPKKTIVRGSMIGHGDYISAMLSDMSRLSVTSSNSLRKSSPSARKRAQSLGRLGEL
NEADALGDGYQYETLDDPEPHWSERARNIHSASGTPYMGLKKSVTLQPNGILPRAKSTYE
VSMSCLDGPLPPHPALPPPPPPPFPVPEPPRPLYLAGDIGSPTERLMMRREFPIIFTHNP
RPITCFYSPTQMPMQQPHGDSLTPDMRSANRLLVHPQNSPGRPFSSYDLKSDSGMRPPAG
FLHSGTSSPLVSGGRHQASVRSSCSYTLGLSPNISYRPPAPDPFMRHSGLYPRQDSPSQP
RPSPTGSLAHSPPGTCSPAFRAPQQPSPRPPPDPPKVTHEQFKAALQMVVDKGDPRSYLE
NFVKIGEGSTGVVCIAREKHSGRVVAVKMMDLRRQQRRELLFNEVVIMRDYQHRNVVEMF
KSALVEEELWVIMEYLQGGALTNIVSETRLSEEQIATVCEAVLQALAYLHSQGVIHRDIK
SDSILLSLDGRIKLSDFGFCAQISKDIPKRKSLVGTPYWMAPEVISKSPYGTEVDVWSLG
IMVVEMVDGEPPYFSETPVAAMKRLRDELAPTVRNVHQVSPMLKDFLDRMLTRDPLERAS
ATDLLEHPFLLQASSPQCLVPLVEQYRKRMSRC
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgtttcgcaaaaagaagaagaagaggcctgagatttcagcaccgaagaactttgagcat
cgagttcatacgtcgtttgatgcaaagcgtggagttttcgtcggccttccaacacaatgg
cagagtttaatagaaaacctgcggagacccaaacccatggtggatccttccagaataaca
ccggtggagctcaaaccaaagaagaccattgtgcggggcagtatgattggccacggggat
tacatctctgccatgttgtccgacatgagccgtctgtcagtcaccagctccaactctctg
cggaaaagcagcccgtcggcccgcaagagagcgcagtctttgggccggctaggggagctg
aacgaggcagatgcattaggcgatgggtaccagtatgagactctggatgatcctgagccg
cactggtctgagcgggcacgaaacatccacagcgccagcgggacaccgtacatggggctg
aaaaaaagcgtgactctacaacccaacggcattttacccagggctaaatccacctatgag
gttagcatgagctgtttggatggcccattgccacctcatccagcgctcccgcccccccca
ccacccccatttcctgtcccggaaccaccgcggcctctttatctagccggagacattggc
agcccgacggagaggctgatgatgaggagagagtttcccataatattcacacacaacccc
agacccatcacctgtttctacagtcccacacagatgcccatgcagcagccgcatggagac
agtctgacgccagacatgaggagcgccaacagactgctggttcatccgcagaacagcccc
ggcagacccttctcatcatacgatctcaagtcagactctggcatgcgcccgccggcgggt
ttcctccacagcggcaccagcagtcctctagtcagcggcgggcggcatcaagcctccgtc
aggtcctcctgcagctacaccctcggcctctcccccaacatcagctatcggccgccggct
ccagaccccttcatgcggcactcaggcctgtacccccggcaggacagcccgtcgcagcca
cgcccatcgcccacaggctctctggcacacagtcccccgggcacctgctcgcctgcattc
agagccccgcagcagccctcaccccgcccaccgcccgacccacccaaagtcacacatgag
cagttcaaggcggcgctgcagatggtggtggataaaggagacccgcgctcctacctcgag
aactttgtgaagatcggggagggttcgacgggtgtggtgtgcatcgctcgagagaaacac
agcggacgcgtggtggccgtcaagatgatggacctgaggagacagcagaggagagaactg
ctcttcaatgaggtggtgattatgagggattaccagcacagaaatgtggtggagatgttc
aagagcgctctggtggaggaggaactctgggtgatcatggagtatctgcagggtggagct
ctgaccaacatcgtgtctgaaaccaggctgagcgaggagcagatagcgacggtgtgtgag
gctgttctgcaggctctggcgtatctgcactcgcagggagtcattcatagagacatcaag
agcgactccatcctgctgtcactggacggacgtatcaagctgtcagactttggcttctgc
gctcagatcagtaaagacatcccgaagagaaagtctctggtaggaacgccgtactggatg
gctcctgaagtcatctccaaatctccatacggaactgaggtggatgtttggtctctgggc
atcatggtggtggagatggtggatggagaaccgccgtacttcagtgaaactcctgtggcg
gcgatgaagagactgagagacgaacttgcaccgactgtacgaaacgtccatcaggtgtct
ccaatgctgaaggactttctggaccgtatgctgacgcgtgatcctctggagcgggcgagc
gccacagatctgctggagcatccgttcctcctgcaggccagttctccacagtgcctggtg
cccctggtggagcaatatcgcaagcgcatgtcccgctgctga

KEGG   Danio rerio (zebrafish): 266749
Entry
266749            CDS       T01004                                 

Gene name
pak2a
Definition
(RefSeq) serine/threonine-protein kinase PAK 2a
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    266749 (pak2a)
   04012 ErbB signaling pathway
    266749 (pak2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    266749 (pak2a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    266749 (pak2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    266749 (pak2a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     266749 (pak2a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE20 family
   266749 (pak2a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo zinc-ribbons_6 Haspin_kinase
Other DBs
NCBI-GeneID: 266749
NCBI-ProteinID: NP_001002717
ZFIN: ZDB-GENE-021011-2
Ensembl: ENSDARG00000068177
Vega: OTTDARG00000017540
UniProt: Q6DG42
LinkDB
Position
2
AA seq 517 aa
MSDNGELEDKPPAPPVRMSSTFSTGIKDSMSTNPSSKPLPSVPEEKRDKPRNKIISIFSA
EKGRKKDKDKERPEISNPSDFEHTIHVGFDSVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLKFYDSTGNSRQKYLSFTDKDAPQAKKGSEQSPVKDPDDDDEDAPPPVVAPRP
QHTISVYTRSVIDPIPAPAAIADTDGSKAADKQKKGKGKMTDEEIMEKLRTIVSIGDPKK
KYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIV
NFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHR
DIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIW
SLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEK
RGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgtctgacaacggagagctggaggacaaaccccctgcccccccagtcagaatgagcagc
accttcagcaccggtattaaagacagtatgtcaacaaaccccagctctaaacccctgccc
tccgtcccagaggagaagagggacaaaccgcgcaacaagatcatatcaatattctcagct
gagaaaggaagaaaaaaagacaaggataaggagcgtccggagatttctaacccttcagat
ttcgagcacactatacatgtgggctttgattctgtcacaggggagttcacgggcatgcca
gagcagtgggctcggctactgcagacctccaacatcacgaaatctgagcagaagaaaaac
cctcaggctgtgttggacgtgctcaaattctacgactccacaggcaacagcaggcagaaa
tacctcagcttcacagataaagatgcaccacaagcaaaaaaaggctcagagcaatctcct
gtcaaagaccctgatgatgatgacgaggatgctccaccccctgttgtagcaccacgccca
cagcacaccatatctgtatacactcgttctgtcatcgatcctattccagcacctgctgcc
attgcagacacagatggctctaaagctgcagacaaacagaagaagggcaagggaaagatg
accgatgaggagattatggagaaacttagaaccattgtcagtattggagaccccaagaag
aaatacacaagatacgaaaaaattggacaaggtgcgtctggtacagtgtacacagccatt
gatgttgctactggccaagaggttgctattaagcagattaacctacagaagcagcccaaa
aaagagctgatcatcaatgagatcctggtgatgaaggagctgaagaatccaaacattgtc
aacttcttagacagcttcttggttggagatgagctctttgtggtgatggagtatcttgct
ggaggctctctgacagacgtagtaacagaaacctgcatggatgaggctcaaattgctgct
gtctgcagagagtgtttacaagcactggagtttctgcatgcaaaccaggtcatccatcga
gacatcaaaagtgacaacgttcttttaggaatggacggatcagtcaaactaaccgatttt
gggttctgtgctcaaatcactccagagcaaagcaagaggagcaccatggtgggaacaccc
tactggatggcccctgaggtggtcacacgtaaagcctacgggcccaaagtggacatttgg
tctttgggtatcatggccattgaaatggttgagggcgaacctccatatctcaatgaaaat
cctctgagggcgttgtacctcatcgctactaatggcaccccggagctccagaacccagaa
aagctgtctcccatttttagagacttcctaaaccgctgcctggagatggatgtggagaag
agaggaggaggaaaagagcttctgcaacatcctttcctcaagctggcaaagcctctttcc
agcctcactcctcttatacttgctgccaaggaggcaatgaagagtaaccgttag

KEGG   Danio rerio (zebrafish): 325034
Entry
325034            CDS       T01004                                 

Gene name
pak2b
Definition
(RefSeq) serine/threonine-protein kinase PAK 2b
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    325034 (pak2b)
   04012 ErbB signaling pathway
    325034 (pak2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    325034 (pak2b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    325034 (pak2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    325034 (pak2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     325034 (pak2b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE20 family
   325034 (pak2b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Spt5_N Kdo zinc-ribbons_6 CDC45 TFIIE-A_C
Other DBs
NCBI-GeneID: 325034
NCBI-ProteinID: NP_001020627
ZFIN: ZDB-GENE-030131-3759
Ensembl: ENSDARG00000018476
Vega: OTTDARG00000023322
UniProt: Q4V9B9
LinkDB
Position
22
AA seq 539 aa
MCDNGDVEDKPPAPPVRMSSTIFSGAKDHALTANHSSKPLPSVPEERKRNKIYSIFSGAE
KGGRRKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGTPEQWARLLQTSNITKSEQKKN
PQAVLDVLKFYDSTGNGRQKYLSFSSEKDSFPSGEQSPAKKTPEPSSPVKAVDDEDNGED
EDDDDDDDEETPPPVVAPRPEHTKSVYTRPSVIDPLPPPVTSPESDAASKATDRQRPKKG
KMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQ
PKKELIINEILVMKELKNPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQI
AAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVG
TPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQS
PEKLSPIFRDFLGRCLEMDVEKRGGSKELLQHPFLKLAKPLSSLTPLILAAKDAMKNNR
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgtgtgataatggcgatgtggaggacaagccgcccgctccgcctgtcaggatgagcagc
accatcttcagcggcgccaaagaccacgccctcaccgccaatcacagctccaagcccctc
ccatcggtccctgaggagcgcaagcgcaacaagatctactccatcttctccggcgcagag
aaaggtggacgcaggaaggatcgtgataaagagcgtcctgaaatctctccaccgtcagac
ttcgagcacaccattcatgtgggatttgacgccgttactggagagttcactggaacgccg
gagcagtgggctcgattactgcagacctccaacatcaccaagtcggagcagaagaaaaac
ccgcaggccgttctagacgtgctcaagttctacgactccacaggcaacggcagacagaag
tacctcagtttctcctcagagaaggacagctttccctccggtgaacagtcgcctgcaaag
aaaactccagagccgtcgtctccagtcaaagcagtggatgatgaagataatggtgaagat
gaagacgatgatgatgatgatgatgaagaaacgccgccgcctgtcgtagcaccccggcct
gaacacactaagagcgtttacactcgaccgtcggtcatcgacccactccccccgccggtg
acgtctccagaaagtgacgcagcgtcgaaggccactgaccgacagagacccaaaaagggc
aagatgacggacgaggagatcatggacaagctcagaaccatagtcagcattggagacccc
aaaaagaaatacacacgatatgagaagatcggacaaggagcgtcaggaaccgtgttcacc
gcaatagacgtcgccactggacaggaggtggccatcaaacagatcaacctgcagaaacag
cccaagaaagagctgatcatcaacgagatcctcgtcatgaaggagctgaagaatccaaac
atcgtcaacttcttagacagttttcttgtaggtgaggagctgtttgtggtgatggagtat
ttggccggcgggtcgctcaccgatgtcgtaactgagacctgcatggatgaagctcagatc
gccgctgtgtgccgagagtgtttgcaggcgctggagtttcttcatgctaatcaggtcatt
catcgagacatcaagagcgacaacgtgcttctaggaatggacggttctgtcaaactcacg
gacttcggtttctgtgcccagatcactcccgaacagagtaagaggagcacgatggtgggt
acgccgtactggatggctccggaagtggtgacgcgcaaagcctacggacccaaagtggac
atctggtcattgggcatcatggctatcgagatggtggagggagagccgccgtatctcaat
gagaatccactgagggcgctgtacctgattgcaaccaatggcactccagagttgcagagt
cccgaaaagttgtcgccaatcttccgagacttcctaggtcgctgtctggaaatggacgtc
gagaagagaggtggaagcaaagagcttttgcagcatcccttcctgaagttggccaaacct
ctctccagtctcactcctctaattctggccgccaaggacgccatgaagaacaaccgctag

KEGG   Danio rerio (zebrafish): 373103
Entry
373103            CDS       T01004                                 

Gene name
pak1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    373103 (pak1)
   04012 ErbB signaling pathway
    373103 (pak1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    373103 (pak1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    373103 (pak1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    373103 (pak1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    373103 (pak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    373103 (pak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    373103 (pak1)
   03036 Chromosome and associated proteins [BR:dre03036]
    373103 (pak1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     373103 (pak1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE20 family
   373103 (pak1)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    373103 (pak1)
 Endocytosis
  Macropinocytosis
   Kinases
    373103 (pak1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     373103 (pak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like SOG2 Kdo CCDC106
Other DBs
NCBI-GeneID: 373103
NCBI-ProteinID: NP_958485
ZFIN: ZDB-GENE-030826-29
Ensembl: ENSDARG00000103959
UniProt: Q803Z0
LinkDB
Position
18
AA seq 577 aa
MSDNGEVEDKPPAPPMRNTSTMIGSSGKDSGPLNHGSKPLPPNPEDKRRKEGFIRSILTG
GGDKTNKKKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSKETSNNQKYMSFTDKGVENFNSSSAVVPKTVSETPAVATVSEDEDEEE
DEATPPPVIAPRPENTKSIYTRSVIEPLPPPLSTKDAATSPITNAAADGGSSSNAPSSNT
NTTNTTNTTNTTNTTSTSAASSTNAPSTPQTTDKSRKKKMSDEEILEKLRSIVSVGDPKK
KYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIV
NYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHR
DIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIW
SLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAVFRDFLNRCLEMDVEK
RGSAKELLQHQFLKVAKPLSSLTPLIIAAKEAAKNNR
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgtcagacaatggggaagtagaggacaagccgccagctccgcccatgaggaacaccagc
actatgattggctcgtccggtaaagactcaggaccgctgaatcacggctccaaaccgctg
ccgcccaatccagaggacaagaggaggaaagagggattcatacgatccatcctgaccgga
ggaggagacaagaccaataagaaaaaggagcgtccagagatctccctgccatcagacttt
gagcacaccatccatgttggctttgacgccgtcactggagagttcactggcatgcctgag
cagtgggctcgattactccagacgtccaacatcaccaaactggagcagaagaagaatcct
caggccgttctagacgtgctcaaattctacgactcgaaagagacgtccaacaaccagaaa
tacatgagctttacagataaaggtgtggagaacttcaactcctccagcgcagtggtcccc
aaaactgtgtctgaaacgcccgccgtcgccaccgtctccgaggatgaggacgaggaagag
gatgaagccacgccgccacccgtcatcgccccccggccagaaaacaccaaatctatctac
acccgctccgtcatcgagcctcttcctcctccgctctccaccaaagacgccgcaacttca
ccgatcacgaacgcagccgcagacggaggatcatccagcaatgcgccttcatcaaacaca
aacaccacaaacaccaccaacaccacaaacaccaccaacaccacctccaccagcgccgcc
tccagcaccaacgctccatccactccacagaccacagacaagagccgcaagaagaagatg
agcgacgaggagattctggagaaactcaggagtatagtcagcgtcggcgacccgaaaaag
aagtacacgcgctttgagaagatcggccagggggcatctggaaccgtctatacagccata
gacatcgctacaggacaagaggtggccatcaaacagatgaacctgcagcagcagcccaag
aaagagctgatcatcaacgagatcctggtcatgagggaaaacaagaacccaaacatcgtc
aactacctggacagttatctggttggcgatgagctgtgggtggtgatggagtatctggct
ggaggctcgctgacggatgtggtgacagaaacctgtatggatgaagcacagatcgcagcc
gtctgtcgggagtgtctgcaggctctggagttcctgcactgcaatcaggtgattcacaga
gacatcaagagcgacaacatcctgctggggatggacggctccgtcaaactcactgatttc
ggcttctgcgctcagatcactcccgagcagagcaagcgcagcacaatggtcgggacgccc
tactggatggcgccggaggtcgtgacccgcaaggcttacgggcccaaagtggacatctgg
tctctgggcatcatggccatcgagatgatcgagggcgaaccgccctacctcaacgagaac
ccgctccgggctctgtatctgatcgccactaatgggacgccggagctgcagaacccagag
aaactttctgctgtatttcgggattttctaaaccgctgtttggagatggacgtggagaaa
agaggctctgccaaagagctcctacagcaccagttcctgaaggtggccaagcctctgtcc
agcctcacgcccctgatcatagcggccaaagaggcagcaaaaaacaaccgctag

KEGG   Danio rerio (zebrafish): 405898
Entry
405898            CDS       T01004                                 

Gene name
pak5
Definition
(RefSeq) serine/threonine-protein kinase PAK 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    405898 (pak5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    405898 (pak5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    405898 (pak5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    405898 (pak5)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     405898 (pak5)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE20 family
   405898 (pak5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 405898
NCBI-ProteinID: NP_998127
ZFIN: ZDB-GENE-040426-2085
Ensembl: ENSDARG00000030154
Vega: OTTDARG00000037148
UniProt: Q6NVJ4
LinkDB
Position
20
AA seq 711 aa
MFGKKKKRLEISAPSNFEHRVHTDFDPQQQKFTGLPQQWQSLLADTANRPKPMVDPSYIT
PIQLAPMKTIVRGSRAPRDASINGLLEEFDSISVSRSNSLRRESPAAAAAAAGSRAQNGF
GQYGRYSCDLDSGVCVEAEWQRSSLRQNGHPGLGPGPIRSPFYPDAMPQKASEWARLPPD
YHAYLESRTQLCGEGPVGRRDYRASLGGSSLDYRDAPLGTPSRLSLRSDHTSCPDADWGF
GELHKRPKSSYGSHGSPQPALRQRSRSGSGLQEPSSSSGSSGAPYSISALSAAPPQGSYS
SYTYPRLSENTSAMIIGKAEYERVCRDGSPQAVCEPYPRVPLKLPHSKALYPPVLQYPPL
LCQPSPYQHPPSQPSPPYTPAGAHAHSHTHSQPSSPYVPPGAYPPPSWGSPAEQPPPRVS
HEQFRAALQLVVEPGDPRQGLDSFLKIGEGSTGIVCIATEKHSGKQVAVKKMDLRKQQRR
ELLFNEVVIMRDYHHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIATV
CLSVLKALSYLHTQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPY
WMAPEVISRLPYGTEVDIWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNLPPRLKESHK
VSSVLRAFLDLMLVREPSQRASALELLQNPFLKLAGPPACIVPLMRHYRPR
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgtttggaaagaagaagaagcgtctggagatttcggctccgtctaacttcgagcaccgc
gtgcacacagacttcgacccgcagcagcagaagttcaccggcctgccgcagcaatggcag
agtctgctggcggacacagccaaccggcccaaacccatggtggacccgtcctacatcaca
cccatacagctggctcctatgaagactatcgtgcggggcagcagagcacccagagacgcc
tccatcaacggcctgttggaggagttcgacagcatctcggtgtcacgctccaactctttg
cgcagggaaagtccggcggcagcggcagcagcggcgggcagcagagcgcagaacggcttt
gggcagtatggccgctactcctgcgatctggacagtggagtgtgtgtggaggcggagtgg
cagcgctcctcactgcggcaaaacggacaccccggccttggccccggccccatccgtagc
cccttctaccccgacgccatgccgcagaaggcctcggagtgggccaggctgccgccggat
taccatgcgtacctggagagccggacacagctctgcggggaggggccggtgggccggcgg
gactaccgcgcatctttgggcggctccagcctggactacagggacgctccgctgggcacg
ccgtcccgcctgtcactccgcagcgatcacaccagctgtccagatgcagactggggcttc
ggtgagctccacaagcggcccaaatcttcctacggcagccacggcagtcctcagccggcg
ctccggcagcgctcacggtccggctcgggtctgcaggagcccagcagcagcagcggcagc
agcggcgctccctacagcatcagtgcgctctctgcagcaccaccgcagggctcctacagc
tcttacacctaccccagactctccgaaaacacctccgctatgatcatcggcaaggcggag
tacgagcgagtgtgtcgtgatggcagtcctcaggcagtgtgtgagccgtatccgcgtgtg
ccgctgaagctcccgcacagtaaagctctgtacccgccggtgctgcagtacccgccgctg
ctgtgccagccatccccgtaccagcacccgccatcacagcccagcccgccctacactccg
gcgggcgcacatgcacactcacacacgcactcacagccgtcctcgccctacgtcccgccc
ggggcctaccctccgcccagctggggctcgcccgcggagcagcccccccctcgggtatcc
catgagcagtttcgggcggcgctgcagctggtggtggaacccggggacccgcgccagggc
ctggacagcttcctgaagatcggcgagggctccacgggcatcgtctgcatcgccaccgag
aagcacagcggcaaacaggtggcggtcaagaagatggacctgcggaaacagcagcggcgc
gagctcctgttcaacgaggtggtcatcatgagggattaccatcatgagaatgtggtggac
atgtacaacagctacctggtgggagacgagctctgggtcgtcatggagttcctggagggc
ggagctttgactgacatcgtcacgcacaccaggatgaatgaggaacagatcgccaccgtg
tgtctgtcagtcttgaaggcgctctcatatctgcacactcagggcgtcattcacagagat
atcaagagtgactccatcctactgaccagtgacggacggatcaaactttctgacttcggc
ttctgtgctcaagtgtctaaagaggttcccaagaggaagtccttagtggggacgccgtac
tggatggctccggaggtcatctccaggttaccctatggcactgaggtggacatctggtct
ctgggcatcatggtgatagagatggtggatggagaaccaccgtacttcaacgagccgcca
ctgcaggccatgcgaagaatacgagacaacctgccacccagactcaaggagtctcacaag
gtgtcgtcggtgttgcgggcgttcctggatctgatgctggtgcgagagccgtcccagcgg
gcgtcagcactggagctcctgcagaaccccttcctgaagctggcaggacccccggcctgc
attgtcccactgatgcggcactaccggccccgctga

KEGG   Danio rerio (zebrafish): 431769
Entry
431769            CDS       T01004                                 

Gene name
pak4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    431769 (pak4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    431769 (pak4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    431769 (pak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    431769 (pak4)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     431769 (pak4)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE20 family
   431769 (pak4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 431769
NCBI-ProteinID: NP_001002222
ZFIN: ZDB-GENE-040704-69
Ensembl: ENSDARG00000018110
Vega: OTTDARG00000040061
UniProt: F1QZR2
LinkDB
Position
15
AA seq 664 aa
MFSKKKKQRIQISAPSNFEHRVHTDFDEQEQKFVGLPRQWQSLIEDTAKRPKPFIDATVI
TTVEPRKTIVRGRKIGDDGSLTWLLDEFETMSVIRSNSLRRGSPPLQPRSDSGSSGGHEN
GEHPQYRHTDRYGDSKEREKPRQEHPGTDPRQSQRPGRSSREDGRPQQQPRGQEPSRHKE
PDWITPGQHREREWDREREPRDYSDHVVRREGANDKRPKSSYTGRDSSPQSPREKRPLSG
PNIRTPNLPVTEGVIKAAQQTGRPFNTYPRSESDSGRTPSGQDLKPAKSHESTHHNGPSA
GPVRGGSSSSSSGGGQTSSQGPHRSEPQHHASHPALGPEPPHGQPMPPPPKPSGPAAPSQ
PTRSPQREPQRVSHEQFRAALQMVVDPGDPRTYLDHYIKIGEGSTGIVCIATVKTTGKLV
AVKKMDLRKQQRRELLFNEVVIMRDYHHENVVEMYNSYLVGDELWVVMEFLEGGALTDIV
THTRMNEEQISTVCLSVLKALSVLHSQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSK
EVQRRKSLVGTPYWMAPELISRLPYGPEVDIWSFGIMVIEMVDGEPPYFNEPPLKAMKMI
RDNLPPKLKNLHKVSPLLKGFLDRMLVRDPAQRATAQELLKHPFLTKAGPPSCIVPLMRQ
NRMR
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgttcagcaagaagaaaaagcaacgcatccagatctcagcaccttcgaactttgagcat
cgtgtccacactgattttgatgaacaggagcagaagtttgttggccttccacgccaatgg
cagagcctcattgaagacacggccaagaggcccaaacccttcatcgatgccacagtcatc
actactgttgagccacgcaagacaattgtccgaggtcgtaagatcggtgacgatggctcc
ctcacctggctcctggatgagtttgaaaccatgtcggtgatccgctccaactccctgcgg
agaggcagtccacctttacaaccacgcagtgactctggatcatcaggaggccatgagaac
ggcgaacacccccaatatagacacactgatcgctatggggacagcaaagagagggagaaa
ccacgtcaggagcacccaggcactgatcctagacagtctcaacgtccgggccgttcgtcc
agagaggatggccggcctcagcagcagcctcgtggtcaggagcccagcagacacaaagaa
cctgactggattacaccgggccaacaccgagaacgagaatgggacagagaacgagaacca
cgtgattattctgaccacgtagtaaggagagagggggccaacgataagaggcccaaatcc
agctatactgggagggatagcagcccacagtcgcctcgtgagaagagaccactgtcaggg
ccaaacatccgcactcctaacctacctgttacagagggagtgataaaggcagcacagcag
actggccgacctttcaacacatacccacgctctgaaagtgactctgggagaacccccagc
ggtcaggatttaaagccagctaaatctcacgagtctacccaccacaatggcccctctgct
ggcccagtccggggtggcagtagcagcagcagcagcggtggtggtcaaacttcttctcag
gggcctcacagatcagagcctcagcatcacgcctctcatccagccttggggcctgagcct
cctcacggccagcccatgcctcctccaccaaaaccatctggcccggctgcaccatcccag
ccgacacgctcacctcagcgagagccacagcgggtctcacacgagcagttcagagctgcc
ctgcagatggtagttgatcctggcgacccgcgtacttatctggatcactacattaagatc
ggagaaggctccacgggcattgtgtgcatagctactgtgaagaccacaggcaaactggtg
gcggtgaagaagatggacctgcgaaaacagcagcgacgagaactgctgttcaatgaggtg
gtgatcatgcgggactatcaccatgagaacgtggtggagatgtacaacagttacttggtg
ggggatgaactctgggttgtcatggagtttctggagggcggcgctttgactgatatagtc
acacatacaaggatgaacgaggagcagatctccaccgtgtgtctgtcagtgctaaaagct
ctctcagtccttcactctcagggagtcattcatagagacatcaagagtgactccattctt
ctcacccatgatggccgtgtgaagctgtcagactttggtttttgcgcccaggtctctaaa
gaggtgcagcgcagaaagtctctggtaggaacgccctactggatggcccctgagctcatc
tcaagactcccatatggaccagaggtggacatttggtcatttggcattatggtcatcgaa
atggtggatggagagccgccgtacttcaacgagccaccgctcaaggctatgaagatgatc
cgagacaatttgccacccaagctcaaaaatctccacaaggtatcgcctcttctcaaggga
ttcttggacaggatgctggtgcgagatcctgcccagagagccacagctcaagagctgcta
aaacatcccttcctgactaaagcaggccctccctcctgcattgttcctctcatgagacaa
aaccgcatgagatga

KEGG   Danio rerio (zebrafish): 567874
Entry
567874            CDS       T01004                                 

Gene name
pak6b
Definition
(RefSeq) serine/threonine-protein kinase PAK 6b
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    567874 (pak6b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    567874 (pak6b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    567874 (pak6b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    567874 (pak6b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     567874 (pak6b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE20 family
   567874 (pak6b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 567874
NCBI-ProteinID: NP_001155959
ZFIN: ZDB-GENE-041014-121
Ensembl: ENSDARG00000052405
Vega: OTTDARG00000016837
UniProt: A5PEY8
LinkDB
Position
20
AA seq 607 aa
MFQRRKKKKRKLEISTPKNFQHRVHTSFDPVQGCFIGLPPQWQSLIETLKRPKPVVDPSS
FTQVQVRPQKSIVRGSFIGHEDYISAAIAQMSRLSVTSSNSLRRRSPSVRKRAQSLGRLG
ELAEAETYEYEELNNTNHRNSSDLHRGSRPIQSPQTESRQSPARARSVHEATMFTGLMPR
DILLHRAGCEGTDNAGNKPNQRPVSCLYSQSDGAKLNSDQLKMETQRRPQSTYDFKVNSP
NLPAASKPNGTSSPKPGHGIISMQTPRRSSTDNTLKLSTIPADVPPAQDSPSEPRQAPSG
ASSPGLTEPSVTHTQFRAALQMVVDPGDPRSYLENFIKIGEGSTGVVCIAREKHSGRQVA
VKMMDLRKQQRRELLFNEVVIMRDYRHQNVVEMYKSALVGEELWVIMEYLQGGALTNIVS
ETRLTEEQIATVCESVLQALCYLHSQGVIHRDIKSDSILLTLDGRVKLSDFGFCAQISKD
VPKRRSLVGTPYWMAPEVVSKTPYGTEVDIWSLGIMVVEMVDGEPPYFSETPISAMKRLR
DEPPPTARNASKISPVLRDFLDSMLTREPQQRSSASDLLQHPFLLQCSSPRCLIPLVEQT
RRRTSRC
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgttccagaggaggaagaagaagaagaggaagttggagatctccacacctaagaacttc
cagcaccgcgtgcacacttcttttgacccagttcagggttgttttatcgggttgccgccg
caatggcagagcctcatagagacgctgaagaggcccaaaccagtggtggacccgtccagc
ttcacacaggtgcaggtcagaccacagaagagcatcgttcgtggaagtttcatcggacac
gaggactacatttcagcggcgatcgctcagatgagccgactctccgtcaccagctccaac
tctttaagaagaaggagtccgtctgtgagaaaaagagcgcaatcattaggtcgactgggg
gaattagcagaagcagagacttatgaatatgaggaactcaataatactaaccacaggaat
agttcagatttacacagaggatccagaccgatccagagtccgcaaactgagtctagacaa
tcaccagcaagagctcgatccgttcacgaggcgaccatgtttacaggactgatgcccaga
gatatcttactgcacagggctgggtgtgaaggaaccgataatgctgggaataaaccaaac
cagaggccggtgtcgtgtttgtacagccaaagtgatggagccaaactgaactcggatcag
ctgaagatggagacgcagaggaggccgcagtctacctatgactttaaggtcaattctcca
aatcttccagctgcatctaaacccaatggcaccagcagtccaaaaccaggccatgggata
atctctatgcagacgcctcgccgttcctccactgataacaccctcaaactctccactatc
ccagccgatgttcctccagcacaggacagcccgtcagagcccagacaggccccaagcgga
gcctcgtctcctgggctgacagagcccagcgtcacacacacacagttcagagccgcgctg
cagatggtggtggatccgggagacccgcgctcatacctggagaacttcatcaagatcggg
gagggctcgactggggtggtgtgcatcgccagagagaagcacagcggacgacaggtggcc
gtcaagatgatggacctgcgcaaacagcagaggagagagctgctcttcaatgaggtggtg
atcatgcgggactacaggcatcagaatgtggtggagatgtacaagagtgcgctggttggt
gaagagctgtgggtgatcatggagtacctgcagggcggcgctctcaccaacatcgtctca
gagaccaggctgacagaggagcagatagcaacggtgtgtgagtctgtcctgcaggctctg
tgttatcttcactctcagggagtcatccacagagacatcaagagcgactccatcctgctg
acgttggacggcagggtcaagctgtcagactttggcttctgtgctcagatcagtaaagac
gtacccaagaggaggtctctggtcgggactccatactggatggcaccggaggtggtttct
aagacgccgtacggcactgaggtggatatttggtctctgggcatcatggtggtggagatg
gttgatggagaacctccgtattttagcgaaacaccaatttctgctatgaagagactgaga
gacgagccgccgccgaccgccagaaacgccagcaagatctctcctgtcctgcgggacttt
ctggactccatgttgacccgtgagccgcagcagagatccagcgcatctgacctgctccag
cacccgttcctgctgcagtgttcatcaccccgctgcctcatcccactggttgagcagacc
cgcagacgcacatcccgctgctga

DBGET integrated database retrieval system