KEGG   Danio rerio (zebrafish): 100536353Help
Entry
100536353         CDS       T01004                                 

Gene name
ganc
Definition
(RefSeq) neutral alpha-glucosidase C-like isoform X3
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00052  Galactose metabolism
dre00500  Starch and sucrose metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100536353 (ganc)
   00500 Starch and sucrose metabolism
    100536353 (ganc)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100536353 (ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100536353
NCBI-ProteinID: XP_003200424
ZFIN: ZDB-GENE-130530-754
Ensembl: ENSDARG00000074556
Vega: OTTDARG00000038887
UniProt: E7F6D4
LinkDB All DBs
Position
17
AA seq 898 aa AA seqDB search
MEVNVSTESIESVLKSEDKFRKNHEILFYRRQRDKAVSQYFTSYETFVLTDGGASLELCE
RDSQDRLSLQIRATQNGTIRVSIDELQLVKPRYQVSDVLVGELRYEPLRVEWKKEDCVCL
TWGLGQYQLLAFFSPFKLEISCAGEEIVTLNPGNKLCFETLQDPASRSSSNSSEGDENCC
GLWKETFRQFEDIKANGPSSVGLDLSLHGFNHTYGVPEHADTLLLKDTSVSEAYRLYNLD
VFGYEINSRLGLYGSVPLLLAHKPERTAGVFWLNSSETLVDVKYNTEQNEDEDEPPGKKS
RISPRTDVRWISESGTIDCFILLGPTPAQVFSQYAQLTGYQALPPLFSLGNHQCRWNYED
EADVKAVDAGFDLHGIPYDVIWLDIEHTDGKRYFTWDSKRFPNPAELQHHLMKKKRKLVV
ISDPHIKMDPDWSIYCEAKKGGHFVKNREGFDFEGTCWPGESCYLDFSSSKTRLWYARQF
SLSKYEGSTESLFVWNDMNEPSVFNGPEQTMPKDALHHGGWEHRELHNLYGFYQHMATFE
GLLTRSGGTERPFILTRSFFAGSQRLGAIWTGDNVATWEYLKISIPMLLSLSLTGIQFCG
ADVGGFVQDPDPELLVRWYQAGALQPFFRAHSAKMTKRREPWLFGEEVTSAIRSAVQDRY
CLLPYWYTLFHQAHTAALPPIRPLWVEFPKDTSTFAVENQYMIGGALLVCPVTDPGVTEV
KVLLPGSNELWYDTNTSEVHKGARSLDVPVTLTTVLVFQRGGTVVPRRTACGSCTADLQH
YTITLTVALDIKGKADGFLYLDDGHSFNYRDQMQFCLRRFSMQAGRLVNSCANDKGLFVS
DDKVETVVILGLKSVKRKPKLKSGAKRTSVMFEFDKKRGVLTLSGLELEICKDWEIII
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaatgtgtcaactgagtctattgagagtgtactaaagtctgaagataaattt
aggaaaaaccatgaaatcttattttacaggcgacagagagataaagcagtgtctcaatac
tttacctcctacgaaactttcgtcctcacagatggaggggccagtctggagctctgtgag
cgggactctcaggaccgactgtctcttcaaatacgggcaactcaaaatggtaccatccga
gtgtctattgatgagctacagctggttaaaccacgctaccaggtttcagatgttctggtt
ggagagctgagatatgagccgctgagagttgaatggaagaaagaggactgtgtatgtttg
acgtggggtctggggcagtaccagctgctggcttttttttccccattcaaattggagatt
tcctgtgctggcgaggagattgttactctcaacccaggaaataaactctgttttgaaact
ctgcaagatccagctagcaggtcatcttcaaattcatctgagggagatgaaaattgctgc
gggctgtggaaggaaacattcagacagtttgaggacatcaaggcaaatggtcctagttct
gttggtctggacttaagtctacatgggttcaaccatacatatggtgttcccgaacatgct
gataccctgctgttgaaggatacaagtgtctctgaagcgtatcggctgtacaacttggat
gtgtttggctatgagatcaacagcagattgggcctttatggttctgtccctcttttgctc
gctcacaagccagaaaggacagctggagtgttttggttgaactcatctgagactctggtt
gatgtcaagtacaacactgagcaaaatgaggatgaggatgaaccaccagggaaaaaaagc
agaatctcacctcggactgatgtgagatggatatcagagagcggcaccatcgactgcttc
attttgctgggacccacacctgcccaggtgttctctcagtatgctcagctaacaggctat
caggctcttcctccgctcttctccttgggtaatcaccaatgccgctggaactacgaggac
gaggctgatgtaaaagcggtggatgctggatttgacctccacggtatcccgtatgatgtc
atttggctggacatcgagcacaccgatggaaagcgctatttcacctgggactccaagcgt
ttcccaaatccagcagaacttcagcatcatctcatgaagaagaaaagaaagctggttgtt
atcagtgacccacacatcaagatggatcccgattggtcaatttactgtgaagctaagaaa
ggaggccattttgtgaagaacagagaaggctttgattttgaaggaacgtgttggccaggt
gaatcctgttatttggacttcagtagctcaaagacaagattatggtatgccagacagttc
tctctaagcaaatatgaaggctcaacagaatctttgtttgtgtggaacgacatgaacgaa
ccttcagtcttcaacgggcccgaacagaccatgccaaaagatgcgcttcaccatggagga
tgggaacatcgagaactgcacaacttatatggcttctatcagcatatggctacatttgag
ggcttattgacccgttcgggtggcacagagaggccgtttatccttacacgctccttcttt
gctgggtctcagagattaggcgccatctggactggggacaatgttgctacctgggagtac
ttaaagatttcaatccccatgctgctgtctctgagtctgacaggaatacagttttgtgga
gctgatgtagggggcttcgtgcaggatccagaccctgagcttctggttcgctggtatcaa
gcaggggcccttcagccatttttcagggcacactctgccaaaatgaccaagcgtcgtgag
ccgtggctgtttggagaggaggtgacctctgcgatccgctctgctgttcaggacagatac
tgtcttctgccgtactggtacacactgtttcaccaggcacacacagctgcacttccacct
atcagacccctttgggtggagtttcccaaggataccagcacatttgctgtggagaaccag
tacatgattggcggtgctctccttgtgtgccctgtgacagatccaggggtcacagaagtc
aaggttttgctcccagggtctaatgagctgtggtacgacacaaatacatcagaagtacac
aagggtgccagaagtctggatgtaccagtgactctgaccactgtgcttgttttccagcgc
gggggaacagtggtgcctaggagaacagcttgtggatcttgtacagcagacctacagcat
tatacaatcactcttactgtggctctggacattaagggcaaagctgatggatttctttat
ttggatgatggccactcttttaattacagagaccagatgcagttctgtctgcggcgcttt
agcatgcaggccggcaggcttgtcaacagctgtgctaacgataaaggcttgtttgtctct
gatgacaaagtggaaacggtggtcattcttggtctgaaaagtgtgaaaaggaaacccaag
ctcaaatcaggtgcaaagaggacatcggtcatgtttgaatttgacaaaaaacgaggcgta
ttaacattaagtggtttggaacttgaaatatgcaaagactgggaaataataatatag

DBGET integrated database retrieval system