KEGG   Danio rerio (zebrafish): 100536795Help
Entry
100536795         CDS       T01004                                 

Gene name
wu:fb14d09
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00053  Ascorbate and aldarate metabolism
dre00071  Fatty acid degradation
dre00280  Valine, leucine and isoleucine degradation
dre00310  Lysine degradation
dre00330  Arginine and proline metabolism
dre00340  Histidine metabolism
dre00380  Tryptophan metabolism
dre00410  beta-Alanine metabolism
dre00561  Glycerolipid metabolism
dre00620  Pyruvate metabolism
dre01100  Metabolic pathways
Module
dre_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100536795 (wu:fb14d09)
   00053 Ascorbate and aldarate metabolism
    100536795 (wu:fb14d09)
   00620 Pyruvate metabolism
    100536795 (wu:fb14d09)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100536795 (wu:fb14d09)
   00561 Glycerolipid metabolism
    100536795 (wu:fb14d09)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100536795 (wu:fb14d09)
   00310 Lysine degradation
    100536795 (wu:fb14d09)
   00330 Arginine and proline metabolism
    100536795 (wu:fb14d09)
   00340 Histidine metabolism
    100536795 (wu:fb14d09)
   00380 Tryptophan metabolism
    100536795 (wu:fb14d09)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100536795 (wu:fb14d09)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100536795 (wu:fb14d09)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100536795
NCBI-ProteinID: XP_009296559
ZFIN: ZDB-GENE-030131-8536
Ensembl: ENSDARG00000099154
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MLRTVFSRTFPQVFRISSCQHSTIPAPNVQPDVHYNKIFINNEWHDAVSKKTFPTINPAT
GEIICHVAEGDKADVDKAVKAARDAFKLGSPWRRMDASQRGLLLSRLADCIERDAAYLAE
LETLDNGKPYAVSFSVDVPMVVKCMRYYAGWADKWEGKTIPIDGNYFCYTRHEPIGVCGQ
IIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYIASLIKEVGFPAGVVNIVPGF
GPTAGAAIASHMDVDKVAFTGSTDVGHLIQRASSASNLKKVTLELGGKSPNIILSDANME
EAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPFDLNTEQGPQ
VNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTIAREEIFGPV
MQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINCYNVFGVQAP
FGGYKASGIGREMGEYGLENYTEVKTVTIKVPEKNS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaccgttttttcccgaacttttcctcaagtttttcgtatctcctcatgtcaa
cattcaacgattcctgcacctaacgttcagcctgacgtgcattataacaagattttcatt
aataatgagtggcatgatgctgtaagcaagaagacttttccaaccatcaatcctgctact
ggagaaattatctgccacgttgcggagggggataaggctgatgtggataaagcggtgaag
gctgccagagatgcctttaagctgggctctccctggcgccgcatggatgcgtctcagcgt
gggctgctgctgagcagattagcagactgcatcgagagagatgctgcctatttagctgag
ctggagactctcgacaatggtaaaccatatgcagtctccttcagtgtggacgtgcccatg
gtggtcaaatgcatgaggtattatgctggctgggcagacaaatgggagggtaaaaccatt
ccgattgatggcaattacttctgctacacaagacatgagcccattggagtctgtgggcaa
attattccttggaatttccctctattgatgcaggcttggaagctgggtccggctctggcc
actggaaacacagtggtgatgaaggtggcggagcagacgccgctcaccgcattgtatatc
gccagtttgatcaaagaggttggttttcctgctggcgttgtcaacattgtcccagggttt
ggtcccacagcaggagcagccattgcttctcacatggatgtggacaaagtagctttcacc
ggctccactgatgtcggtcacctgatccagcgagcctcgagtgccagtaatctgaaaaaa
gtcacactggagctcggaggaaagagtccaaacatcatcctgtcagatgctaacatggaa
gaagcagtggagcagtcccatatcgccctgttcttcaaccaaggccagtgctgttgcgca
ggcactcgcacttttgtacaggagagcatctacgatgagtttgtggagcgaagtgtggag
agagccaagaataggattgtgggagatccatttgacttaaacacggagcagggcccgcag
gtgaatgaggatcagtttaagaaggttctgggctacatcagcagcgggaagcgtgaagga
gccaagctgatgtgtggaggagctccagccgccgagcgcggatacttcatccagcccaca
gtcttcggagacgtcaaggacgacatgacaatcgctcgcgaagagatcttcgggcctgtt
atgcaaattctgaagttcaaatctttggaggaagtgattgagagagccaacgacagcaaa
tatggcctcgcgggtgctgttttcacccaagacatcgacaaggccaattacatttcccat
ggcctgcgtgctgggactgtgtggattaactgctataacgtgttcggagttcaggctccg
tttggaggctacaaagcgtcaggaattggccgtgagatgggcgagtatggactggagaac
tacactgaggtcaaaacggtgaccattaaagttcctgagaagaactcctaa

DBGET integrated database retrieval system