KEGG   Danio rerio (zebrafish): 114424Help
Entry
114424            CDS       T01004                                 

Gene name
cdh1
Definition
(RefSeq) cadherin 1, type 1, E-cadherin (epithelial) precursor
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04371  Apelin signaling pathway
dre04514  Cell adhesion molecules (CAMs)
dre04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114424 (cdh1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    114424 (cdh1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    114424 (cdh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    114424 (cdh1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:dre04515]
    114424 (cdh1)
   04090 CD molecules [BR:dre04090]
    114424 (cdh1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    114424 (cdh1)
Cell adhesion molecules [BR:dre04515]
 Cadherins
  Major cadherins
   114424 (cdh1)
CD molecules [BR:dre04090]
 Proteins
  114424 (cdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3 DUF4625 Big_9 DUF4999
Motif
Other DBs
NCBI-GeneID: 114424
NCBI-ProteinID: NP_571895
ZFIN: ZDB-GENE-010606-1
Ensembl: ENSDARG00000102750
Vega: OTTDARG00000020300
UniProt: Q90Z37
LinkDB All DBs
Position
7
AA seq 864 aa AA seqDB search
MACVTTVGLGVIFFLFRVFSSGYTHMSICTPGFELEEFVFKVHRNHLHSGKRLGKVTFNN
CDGRTRTLFQSIDKRFEINTDGTVTLKRQVTLHEGHKVFSVHAWDSSGMKHTASVRVERV
PAQVESSSDVDLTKNKRVKRGWIIPPISVSENSKGPFPMRLVQIKSDYAIETRLAYKITG
EGADLDPKGIFTIDRLSGWVSVTQLLDREKKASYKLRAHANGVDADVTEKPMDIIVTVTD
QNDNKPVFTQNPFNGNVPEALEKGEVFMTVTATDADDKENTDNADISYVIISQDPPSPKP
NMFAINPVSGGISVLEKGLDREQWFRYTLVITATDMNGEGLSTTGTAVITVTDSNDNAPL
FEQSSYTASVPENQVGVEVAKLPVTDGDEPESTAWSTKYQIIAGDKGGFFNISTGPSRLE
GIITTVKPLDYEKTKQYILSVIVVNDDKFVGPLPTSTATVTVNVKDVNEPPEFIPKEKFI
SRPENLPVGSNLIPFTAIDPDTEKKQNITYRIGNDPSDWLNITGSGQIQVKNALDRESSN
VKDGKYKALILALDNDVESPATGTGTLVIELQDVNDNAPVINERTIKLCNRESAPVLLSI
TDKDLPPFAGPFKVEPQGDTSKNWSVFFNETGHFLNIKPQSQLEQGEYKVVLRVADREGE
SQENIIQASVCDCKGEAFQCTDKQVAGIPLFGVLGVLGGILLLLLLALLLLMFLRRKSNS
KKEPLLPEDDVRDNIYYYDEEGGGEDDQDFDLSVLHRGLDNRPEVFRNDVAPTFMPAPQY
RPRPANPEEIGTFIDDNLKAADNDPTAPPYDSLLVFDYEGGGSDAGSLSSLNTSSSGNDQ
DYDFLNEWGPRFKKLADMYGGGED
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtgtaacaactgtgggattaggagttatcttttttctttttcgggtcttttcg
agtggatatacgcatatgtcgatatgtacacctgggtttgagttggaggaatttgttttt
aaagtacaccgaaatcaccttcacagtggcaaaagactaggcaaagtgactttcaataac
tgtgatggaagaacaaggacgctctttcagtccattgacaagcggtttgagataaacact
gatggaactgttacactgaagagacaggtgacacttcatgagggccacaaggtgttttct
gtgcatgcctgggactccagtggcatgaagcacacggcatctgtcagagttgagcgtgtc
cctgcacaggtggaatcttcctctgatgtggatctgactaaaaataaaagagtaaagaga
ggttggattattcctccaatcagtgtatctgaaaatagcaaaggtccattcccaatgagg
ctggtccagataaagtcggattatgctattgaaactcggttggcatacaagatcactggt
gaaggggcagatctagaccctaagggtattttcacgatagacagactatcaggatgggtc
agtgtgactcagctacttgacagagaaaaaaaagcatcatacaaacttagggctcatgcg
aacggagtggacgcggatgtcacagaaaagccaatggacattattgtaactgtgacagac
caaaatgataataagcctgtgtttactcaaaacccttttaatggaaatgttcctgaagct
ttggaaaagggtgaagtatttatgacagtcacagccactgatgcagatgataaagaaaac
actgacaatgctgatatcagttatgtcattataagccaagatccaccatctccaaaacct
aacatgtttgctatcaatcctgtaagtggagggatttctgtgctggaaaaaggcctggac
agagagcaatggttcagatatactttggttattacggccactgacatgaacggagagggt
ttgtcaaccactggcacagcagttattactgtaactgacagcaatgataacgcacctctg
tttgagcaatcctcgtacactgcatctgtccctgagaatcaagtaggggttgaagtggcc
aaacttccagttactgatggagatgaacctgaatcaacagcctggtcaactaagtatcag
atcattgctggtgacaagggtgggtttttcaatatcagcactggacccagtcgtctagag
ggcatcatcaccactgtgaagcctctggactatgagaagaccaagcagtacattctgtct
gtgattgttgtgaatgatgataaatttgttggtcctttgcctacttcaactgccacagtc
actgtgaatgtaaaagatgtgaacgaaccacctgagtttattccaaaggagaagtttatt
tccagacctgaaaatttacctgttggtagtaatttgatcccttttacagccattgatcca
gacactgaaaaaaagcagaacataacttatagaattggaaatgatccttctgactggctc
aatataacaggctctgggcagattcaagtcaagaatgctttggatcgagaatcttccaat
gtcaaagatggcaaatacaaagctctcattttggctttggataatgatgttgagtctcca
gcaactggcacaggaacactggtaattgaactgcaggatgtaaatgacaatgctcctgtt
attaatgaaaggaccataaaattgtgcaatcgtgaatcagccccagtgcttctctctata
acggacaaagatttacctccttttgctggtcccttcaaagttgagccccaaggtgatacc
agtaaaaattggtctgtttttttcaatgaaactggtcattttctgaatatcaagcctcaa
tctcagttggaacagggtgaatacaaggtggtcctgagagttgctgatcgggagggtgaa
tctcaggagaatattattcaagcaagtgtgtgtgactgcaaaggagaggcattccaatgt
actgataaacaagtagcagggattccactgtttggagttcttggtgtcctgggaggaatc
ttacttctgctattgcttgctcttcttctgctcatgttcctgcggaggaaaagcaactcc
aaaaaagaaccgctccttccagaagatgatgtacgggacaacatctactattatgatgag
gaaggcggtggagaagatgatcaggactttgatttgagtgtcctgcacagaggcctggac
aacagaccagaagtgttcaggaatgatgtggcgcccactttcatgcctgcacctcagtac
agacctcgaccggccaaccctgaggagatcggcacattcattgatgataacctgaaggct
gcagataacgaccccacagctcctccctacgactctctgctggtgtttgactatgaagga
ggaggatcagacgcaggttcactcagctccctcaacacttccagctcaggaaacgaccaa
gactatgacttcctcaatgagtggggcccacgcttcaagaagctagcggacatgtatgga
ggaggagaggattaa

DBGET integrated database retrieval system