KEGG   Danio rerio (zebrafish): 142986
Entry
142986            CDS       T01004                                 

Gene name
ptk2ab
Definition
(RefSeq) focal adhesion kinase 1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    142986 (ptk2ab)
   04370 VEGF signaling pathway
    142986 (ptk2ab)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    142986 (ptk2ab)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    142986 (ptk2ab)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    142986 (ptk2ab)
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    142986 (ptk2ab)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     142986 (ptk2ab)
Protein kinases [BR:dre01001]
 Non-receptor tyrosine kinases
  FAK family
   142986 (ptk2ab)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     142986 (ptk2ab)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M FERM_F2 Kinase-like
Other DBs
NCBI-GeneID: 142986
NCBI-ProteinID: NP_571871
ZFIN: ZDB-GENE-020114-1
Ensembl: ENSDARG00000004672
Vega: OTTDARG00000021096
UniProt: Q98SN4
LinkDB
Position
16
AA seq 1050 aa
MAAAYLDPNPTHALNQGVKPRFSAGMERTAAALERVLKIFHYFESSSEPCSWASNIRHGD
STDVRGIIQKILDIHKVRCVSCFGLRLSHLRTGEIHWLHPDMGVSHVRERYEHSHPQDDW
RYELRIRYLPKGFLNQFTEDQPTLNYFYHQVKSDYMMEIADQVDQDIALKLGCLEIRRFF
RDMPGNALDKKSNYELLEKDVGLRRFFPKSLLDSVKAKSLRKLIQQTFKQFANLNNEQCM
LKFFEILSPIYRFDKECFKCALGSSWVISVELAIGPEEGISYLTDKGSNPTHLANFTQVQ
TIQFEERERKGMLLLDVAGAPEPLTVTTTTLNTAENMADLIDGYCRLVSGTSSSFIVRVQ
KEGERALPSIPKAPKSANHEKRLQGVRAKAISISETDDYAEIIDEEDTYTMPSTRDYEIQ
RDRIELGRCIGEGQFGDVHQGIYICPDTPALSVAIKTCKNCTSDSVREKFLQEALTMRQF
DHPHIVKLIGVITENPVWIIMELCTLGELRSFLQIRKYNLDLASLILFSYQLSTALAYLE
SKRFVHRDIAARNVLVSSVDCVKLGDFGLSRYMEDSSYYKASKGKLPIKWMAPESINFRR
FTSASDVWMFGVCMWEILMYGVKPFQGVKNNDVIGRIENGERLAMPPNCPPTLYSLMTKC
WAYDPSKRPRFTELKGQLSTILAEEKAQQEERSRMEMRRQVPVSWDSGGSDEAPPKPSRP
GYPSPRSSEGFYPSPQHMGQHNHYQMAGHSGPHGLLSVPGGLYPPQATVTGLDPHDSWNH
RRVAQDHMWNPSMEDGVALRGGLSQLMEEQLILQQQQMEDDQRWLEHEERLLKPDGRSSR
GSTERDDGSLQGPTGNQHIYQPIGKAEHAAPPKKPPRPGAPSHAAGVSGLNPTESYNEGV
KIQPQEINPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALR
TLLATVDETIPLLPAHTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQDYKKQMLT
AAHALAVDAKNLLDVIDQARLKLLGQARPH
NT seq 3153 nt   +upstreamnt  +downstreamnt
atggcagcggcttacctggaccccaacccgacccatgctctgaaccagggggtcaagcct
cgcttcagtgcagggatggagcggacggctgcggctctggagcgcgtgctcaaaatcttc
cactacttcgagagcagtagtgaaccctgcagctgggccagcaacatccgacacggggac
tcgactgatgtcaggggcattatacagaagattttagacatccataaggtgaggtgcgtg
tcctgcttcggtctgcgcttgagtcatctgagaacaggagaaattcattggcttcatcca
gacatgggcgtttctcatgtgagggagaggtacgagcacagccatccacaggacgactgg
agatatgagctacggattcgatacttacctaaaggatttttaaaccagtttactgaggac
cagccaactctcaactacttttatcatcaggtgaaaagcgattatatgatggagattgca
gatcaagttgatcaagacatagcacttaaactaggctgccttgaaatcaggaggtttttc
agggacatgcctggtaatgccctggataagaaatcaaattatgaattattagagaaggac
gttggtctgcggagattctttccaaagagtttattagactcagtgaaggctaaatccttg
cggaaactgatccaacagacgtttaagcagtttgccaatctgaacaatgagcagtgtatg
cttaagttctttgagatcctgtcgcctatatacagatttgataaggagtgttttaaatgt
gctctcgggtcgagctgggtgatatcagtggagcttgccatcgggcctgaggagggaatc
agttatttgacagacaaaggctcaaatccaacgcaccttgccaacttcactcaagtgcag
actatccagtttgaggagcgggagaggaagggcatgctgctattagatgtggctggagca
cctgagcctctgacagtaacaactactacactgaacacagcagagaacatggctgatctc
attgacggttactgtagacttgttagtggaacttcctcatcatttattgtccgtgtacag
aaagaaggagagagagcacttccatcaatcccaaaagcaccaaaatcagcaaaccatgag
aagcggttgcaaggagtccgcgccaaagccatttccatctcagaaacggacgactacgct
gagatcatagacgaagaggacacttacactatgccttccacccgggattatgagatccag
agagaccgaatcgagctgggacgctgtataggagagggacagtttggagatgttcatcaa
gggatctacatatgtccggacaccccagctctttcagtggcaataaagacgtgtaagaac
tgcacttcagacagcgttcgagagaagttcctccaggaggccttgacaatgcgacagttc
gatcaccctcacattgtaaaactgattggagtcattacagaaaacccagtgtggatcatc
atggagctgtgcacactgggagagttgcgttcctttcttcagattaggaagtacaatctg
gatttagcatcactcatactgttttcttaccagctcagcacagcccttgcttacctagag
agcaaacgctttgtgcacagggatattgcagcacgaaatgttcttgtgtcttcagtggac
tgtgtgaaactgggagactttgggttgtcgagatacatggaggacagttcttattataaa
gcctctaaaggaaaactacctattaaatggatggcgccagagtcgataaacttcagacgt
tttacctcagccagcgacgtgtggatgtttggagtgtgtatgtgggagatactgatgtat
ggagtgaagccgtttcaaggtgtgaagaataatgatgttataggccggattgagaacggc
gagcgtctggctatgccaccaaattgtccgccaaccctctacagcctgatgaccaaatgc
tgggcatacgaccccagtaaacgcccacgattcaccgaactcaaaggccaactgagtacg
atcctggcagaggagaaagctcagcaggaggagcgcagccgtatggagatgaggagacaa
gttcccgtgtcctgggactctggaggatcagatgaagcaccacccaaacccagtcgaccg
ggttatccaagtccgcgttctagtgaaggtttctaccctagtcctcagcacatgggccag
cacaatcattaccagatggcagggcattctggcccacatggcctgctctctgtgcccggt
ggtctgtaccctcctcaggccacagtgacaggacttgatccacatgacagctggaaccat
cgcagagttgcgcaggatcacatgtggaaccccagcatggaggatggtgtggctctgcgt
ggaggtctgtctcagctgatggaggagcagttaattctgcagcagcagcagatggaggat
gaccagcgctggctggagcatgaggagagactactgaagcctgatggaagaagttccaga
ggcagcactgagcgtgacgatggaagtcttcagggaccaactggaaaccagcacatctac
caacctatagggaaagcagagcatgcagcccctcctaaaaagccccctcgtcccggagct
ccaagccacgcagcaggagtctctggcctcaaccctaccgagagttacaatgaaggcgtc
aagattcagcctcaggagatcaatccacccccaacggctaacttggatcgctccaacgat
aaagtgtatgaaaatgtgacaggactggtgaaggcagtcattgagatgtccagtaaaatc
cagcctgcgccgcctgaagaatacgtgcccatggtgaaggaagtgggattagcactgaga
acattattggccacagtggatgagaccatacctttattaccagctcacacacacagagag
atcgaaatggcccagaagcttctaaattcagatttggctgagctgataaataaaatgaag
ttggcccagcagtacgtcatgacaagcctacagcaggactacaagaaacagatgctaaca
gctgcgcacgcgctcgccgtagacgccaagaacctgctggatgtgatcgaccaagccagg
ctgaagttgttgggccaggcgcgaccacattag

KEGG   Danio rerio (zebrafish): 386705
Entry
386705            CDS       T01004                                 

Gene name
ptk2aa
Definition
(RefSeq) protein tyrosine kinase 2aa
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04012  ErbB signaling pathway
dre04370  VEGF signaling pathway
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    386705 (ptk2aa)
   04370 VEGF signaling pathway
    386705 (ptk2aa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    386705 (ptk2aa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    386705 (ptk2aa)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    386705 (ptk2aa)
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    386705 (ptk2aa)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     386705 (ptk2aa)
Protein kinases [BR:dre01001]
 Non-receptor tyrosine kinases
  FAK family
   386705 (ptk2aa)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     386705 (ptk2aa)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Kinase-like Peptidase_A22B
Other DBs
NCBI-GeneID: 386705
NCBI-ProteinID: NP_942114
ZFIN: ZDB-GENE-031114-5
UniProt: Q7T2V4
LinkDB
Position
19
AA seq 1045 aa
MATAFLEPTPNHTLSVGAKARLSAGTERVPGAPDRVLKVFHHFENNSEHSTWSSNIRHGD
ATDVRGIIQKIVDIHKVQHVVCFGLRLTHVPSGDVHWLHPDEGVSHVREKFEQKRPQDEW
RYELRIRYLPKGFLTQFTEDKPTLNYFYQQVKNDYMLEVADQVEQEVALKLGCLEIRRFY
REMRGNALDKKSNYELLEKDVGLRRFFPKSLLESVKAKTLRKQIQQTFKQFANLNDEQSV
LKFFEILAPVYRFDKECFRCALGSSWVISVDLAIGPEEGISYLTDKGSTPTHLANLTQVQ
SIHYSCVEEKERKGVLQLDVAGAAEPLTISTPSFSTAENMADLIDGYCRLLNAVNQSFII
RPQKDGERALPSIPKLANNEKRLEGIRAGVRAISVSETDDYAEIIDEEDTYTMPSTQDYE
IQRDRIELGRCIGEGQFGDVHQGVYISPENPSLSVAIKTCKNCTSDSVREKFLQEALTMR
QFDHPHIVKLIGIITENPVWIIMELCTLGELRSFLQVRKYNLDLSTLILFAYQLSTALAY
LESKRFVHRDIAARNVLVSSIDCVKLGDFGLSRYMEDSSYYKASKGKLPIKWMAPESINF
RRFTSASDVWMFGVCMWEILMFGIKPFQGVKNNDVIGRIENGERLAMPQNCPPTLYSLMT
KCWAYDPSKRPRFTELKTQLSTILDEEKLQQEERFRMEMRRQVTVSWDAGNSDEAPPKPS
RPGYPSPRSSDGYFPSPQHAGQHNHYQGSGYPAAHVSSPGFPAQTSILDPLESWNHRQEP
PTWPANAEDGAAVGRTQPMNTHLMEETLIKQQQQMEEDQRWLEQEESFLKPESRNSRSSI
DREDAALQTPMGKQHVYQPVGKTDLVAPPKKPPRPGAPAHLTNLSPADSYNEGVKPWRLQ
PQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSRIQPALPEEYVPMVKDVGLALRTLL
ATVDETIPVLPAHTHREIEMAQKLLNSDLAELISKMRLAQQYMLTSLQQDYKKQMLTAAH
ALAVDAKNLLDVIYQARLKMSHRTH
NT seq 3138 nt   +upstreamnt  +downstreamnt
atggcgacggcattcctggagcccaccccgaaccacacgctgagcgtcggggccaaagcc
cgactcagtgcggggacagagcgggttccgggggcccccgaccgggtcctgaaggtcttc
catcacttcgaaaacaacagcgagcacagcacctggtccagcaacatccggcacggagac
gccactgacgtcaggggaatcattcagaagatcgtggacattcataaagtgcagcatgtg
gtgtgtttcgggctgcgtctcactcatgtgccgtcgggtgacgttcactggctgcaccct
gatgagggcgtgtctcacgtcagggagaagtttgagcagaagcgcccacaggatgagtgg
aggtatgagctgaggatccgttacctgccgaagggcttcctgactcaattcaccgaagac
aaacccacactcaactacttctatcagcaggtgaagaatgactacatgctggaggttgcg
gatcaggtggagcaggaggtggcgctgaagctgggctgtctggagatcaggagattctac
agagagatgaggggaaacgctcttgataaaaagtccaactacgagctcttagagaaggat
gttggtcttcgccgcttcttccccaagagcttgttggagtcggtgaaggctaaaacactg
aggaaacagatccagcaaacttttaagcagttcgccaacctgaacgacgagcagagcgtc
ctcaagtttttcgagatcctggcgcccgtttacagattcgacaaagagtgtttccgctgc
gctctcgggtcgagttgggtcatctcagtggatcttgcgattggtccagaggagggcatc
agttatctgacagacaagggctccacgcccacacacctggccaacttgactcaggtgcag
agcatccattactcctgcgtggaggagaaggagaggaagggtgtgctacagctggatgtc
gctggagccgcagagcctctcacgatcagcacgccgtctttctccaccgccgagaacatg
gccgacctcatcgacggatactgtcgcctgctcaacgccgtcaaccagtccttcatcatc
agacctcagaaagatggtgaaagagctcttccatccattccaaaacttgctaacaatgag
aagcggcttgaggggattcgggcaggagttcgggccatttctgtttcagaaacagacgac
tacgcagagatcatagatgaggaagacacctacaccatgccgtctactcaggattatgag
atccagcgggacaggattgagttgggtcggtgtatcggtgaagggcagttcggtgacgtc
catcagggggtttacatcagtccggagaatccatcattatcagtggccataaagacgtgt
aagaactgcacatcagacagcgttcgagagaagtttcttcaggaagctctgacaatgcgg
cagtttgaccatccgcacatcgtcaagctgatcgggataatcacggaaaaccctgtctgg
atcatcatggagctgtgcacgcttggagagctgaggtcgttcctgcaggtgaggaagtat
aatctggatctgtccacactgattctgtttgcgtatcagctgagcaccgcgctggcgtac
ctggagagcaaacgcttcgtgcacagagacattgcggccaggaatgtgttagtgtcttcc
atagactgtgtgaaacttggtgactttggtctttccagatacatggaggacagttcctat
tataaagcttctaaagggaagctgcccattaaatggatggctcctgaatccatcaacttc
cgccgatttacctccgccagcgacgtctggatgtttggtgtgtgtatgtgggagatcctc
atgttcggcatcaagccttttcagggagtgaagaataacgacgtgattggccggatcgag
aacggagagaggctggcgatgccacaaaactgcccacccacactctacagcctcatgacc
aaatgctgggcgtacgaccccagcaaacggccccgattcacagagctcaagacacagctc
agcacgatcctggatgaggagaagctccagcaggaggagcgtttccgcatggagatgagg
aggcaggtcaccgtgtcctgggatgccggaaattcagacgaagctcctcctaaacccagc
agacctggttacccgagtcctcgctccagtgatggttatttccccagtcctcaacatgct
ggacaacataatcactatcagggctccggatatcctgcagctcatgtgtccagtccagga
ttcccagcgcagacgtccatcctcgacccgcttgagagctggaaccaccgacaggagcct
cccacctggcctgcaaacgcggaggatggagccgctgtgggccgcactcagcccatgaac
acacacctgatggaggagacgctcatcaaacagcagcagcagatggaggaggaccagcgc
tggctggaacaggaggagagcttcctgaagccggagtccaggaactctcgcagcagcatc
gaccgtgaggacgccgctctgcagaccccgatgggaaagcagcacgtttaccagcccgtg
ggcaaaaccgatcttgtggctcctccaaagaaacctcctcgtcccggagctccagctcac
ctgactaacctgagcccggccgacagctataatgagggcgtcaagccctggaggcttcag
cctcaggagatcagtcctcctccgacagccaatctggaccgctcgaatgataaagtgtat
gagaatgtgacggggctggtgaaggccgtgatcgagatgtccagccgcattcagcccgcg
ctgccagaggagtacgtgcccatggtcaaggatgttggtctggctctcaggactctgctg
gcgacggtggatgagactataccagtgttaccagcacacacacatcgagagattgagatg
gcgcagaagctgctgaactctgacctggcggagttgatcagtaagatgcgtctggcgcag
cagtacatgctgaccagcctccagcaggactacaagaagcagatgctgacggcggctcac
gcgctcgctgtggatgccaaaaacctgctggacgtcatctaccaggcccgactcaagatg
agccaccgcacacactga

DBGET integrated database retrieval system