KEGG   Danio rerio (zebrafish): 170581
Entry
170581            CDS       T01004                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04020  Calcium signaling pathway
dre04260  Cardiac muscle contraction
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    170581 (cacna1c)
   04020 Calcium signaling pathway
    170581 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    170581 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    170581 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    170581 (cacna1c)
   04270 Vascular smooth muscle contraction
    170581 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    170581 (cacna1c)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   170581 (cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1 DUF4834
Other DBs
NCBI-GeneID: 170581
NCBI-ProteinID: NP_571975
ZFIN: ZDB-GENE-020129-1
Ensembl: ENSDARG00000008398
Vega: OTTDARG00000008481
UniProt: Q90ZA7
LinkDB
Position
4
AA seq 2168 aa
MVNESKNMYIPEDTLENHQGSNYSSPSLAPVPSLNEDEHVGGGGGVLGLAPKHIPTPGAP
LSWQAAIFAARQAKLMGTTGAPISTASSTQRKRQHYTKPKKQASTASTRPPRALLCLTLK
NPIRRACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYGFLIIF
TVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAG
FDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELF
MGKMHRTCFFYKDGHKGHIAEEKPAPCAPSSAHGRHCSPPNITQCMMGWEGPNDGITNFD
NFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGE
FSKEREKAKARGDFQKLRERQQLEEDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSMP
ASENESVNTDNAPAGDMEGETCCTRMANRISKSKFSRYSRRWNRLCRRKCRAAVKSNVFY
WLVIFLVFLNTLTIASEHHQQPEWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSL
FNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNS
VRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWN
SVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEE
EEEKERKKLARTASPEKRQNSEKPPLEDEKKEEKIELKSITSDGETPTATKINIDEYTGE
DNEEKNPYPVNDFPAGEDDEEEPEMPVGPRPRPLSDIQLKEKAVPMPQAKAFFIFSPSNK
FRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADYVFTGIFTIEI
ILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRA
INRAKGLKHVVQCVFVAIRTIGNIVIVTSLLQFMFACIGVQLLKGKFFYCTDTSKQTQAE
CRGAYILYKDGNVGEPEKAQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSH
AEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ
CVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFN
KAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSVVDIAITEVNPADP
SSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQAL
PYVALLIVMLFFIYAVIGMQMFGKIALRDNSQINRNNNFQTFPQAVLLLFRCATGEAWQE
IMLACSPNRPCEKGSEINHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNFDYLT
RDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRL
VSMNMPLNSDGTVMFNATLFALVRTALRIETEGNLEQANEELRAIVKKIWKRTSMKLLDQ
VVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKIPPKTALSLQAGLRTLHDMGP
EIRRAISGDLTVEEELERAMKETVCAASEDDIFRRSGGLFGNHVNYYHQSDGHVSFPQSF
TTQRPLHISKSGSPGEAESPSHQKLVDSTFTPSSYSSSGSNANINNANNTAIGHRYPKPT
VSTVDGQTGPPLTTIPLPRPTWCFPNKSSDSSDSRLPIIRREEASTDETYDETFLDERDQ
AMLSMDMLEFQDEESKQLAPMVEAEVGEERRPWQSPRRRAFLCPTALGRRSSFHLECLRK
HNRPDVSQKTALPLHLVHHQALAVAGLSPLLRRSHSPTLFTRLCSTPPASPSGRSGGGPC
YQPVPSLRLEGSGSYEKLNSSMPSVNCSSWYSDSNGNHSGRAQRPVSLTVPPVTRRDSIS
LAHGSAGSLVEAVLISEGLGRYAHDPSFIQVAKQEIAEACDMTMEEMENAADNILNANAP
PNANGNLLPFIQCRDTGSQESRCSLSLGLSPATGSDGALEAELEESEGAGQRNSPLMEDE
DMECVTSL
NT seq 6507 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacataccggaggacacccttgaaaaccatcaaggc
tccaactattccagtccgtcgttggctccggtccccagtctgaatgaggacgagcatgtg
gggggcgggggtggggtattgggtcttgcacctaaacacattcccacccctggcgccccc
cttagttggcaggcagccattttcgcggcacggcaggccaagctgatgggcaccaccgga
gcaccaatctccactgcgagctccacgcagcgcaaacgccagcattacaccaaacccaag
aaacaggccagcactgcctccacacgcccaccccgagcccttctctgcctcactctcaaa
aaccccatccgcagggcgtgcatcaatatcgtggaatggaaaccgtttgaaatcataatt
ttgatgactatttttgcaaactgtgtggccttagctgtctacatccctttccctgaggac
gattccaacgcaaccaactcaaatctggaacgggtggagtatgggtttctgatcattttt
acggtggaagcctttctgaaagttattgcttatgggctgctgtgtcaccctaatgcatac
ctgcggaatggctggaacttgttggatttcatcatcgtggtcgtagggctcttcagtgca
atattagagcaggccactaaaggggatggtggtacttcaatgggaggcaaagctgcaggg
tttgatgtaaaagcccttcgagcctttagagtgttgagacctctaagactcgtgtctgga
gtacctagtttacaggtggtgctgaactccatcattaaagccatggttcccctccttcac
atcgctctgctcgttctgttcgtcatcatcatttatgccatcatcggcctcgagctcttc
atgggcaagatgcatagaacctgtttcttctataaagatggacacaaaggtcatatagct
gaagagaagccggccccctgcgctccaagctccgcccatggaagacactgctctccgccc
aacataacgcagtgcatgatgggatgggagggcccaaatgatggaatcacgaactttgat
aactttgcatttgccatgctgactgtgtttcagtgcatcacgatggagggctggactgat
gtcctgtactggatgcaggatgccatgggttatgagcttccatgggtctattttgtcagt
ctggtcatctttggatcctttttcgttcttaatctggttctgggtgtgttgagcggagag
ttctctaaagagcgagaaaaggccaaagctcgtggtgattttcagaagctccgtgagagg
cagcagctggaggaggatctaaagggctacctggactggatcacgcaagcagaggatatt
gaccctgagaatgacgacgagggactggatgacgacaagcctagaaatctgagtatgccg
gccagtgaaaatgagtcagtgaacactgataatgctccagctggagacatggaaggagag
acctgctgtacccgcatggcaaataggatctccaaatccaaattcagtcgatattcacgc
cggtggaatcggttatgtcggcgtaagtgccgtgcagcagtgaaatcaaacgtcttctac
tggctggtgatttttctggtatttttgaacacacttactattgcctcagagcatcaccag
cagccggagtggctcaccaatgtacaagatatagccaataaggtgctgctggctctcttt
accggtgagatgctgttaaagatgtacagtctgggcctacaggcctattttgtctccctt
ttcaaccgatttgacagctttgtggtgtgcggtgggattctggaaaccatcctggtggag
accaaaataatgtcacccctgggcatctctgtgttgcgctgcgtacgtctgcttcgcatc
ttcaagatcaccagatactggaactctctgagtaatctagtggcgtctctgttgaactct
gtgcgttcgatcgcatccctgttactgctgctcttcctcttcattatcatcttcagtctg
cttggaatgcagctctttggtggaaagttcaactttgatgagactcgacgcagcacattt
gataatttccctcagtctctcctcaccgtctttcagattttgaccggagaggactggaac
tctgtgatgtacgatggcatcatggcgtatggagggccgtcctttcctggcatgcttgtc
tgcatttacttcatcatcctcttcatctgtggaaactacatcctcctgaatgtcttcttg
gccattgctgtggacaacctcgcagacgcagagagtctaacatcagcgcagaaagaggaa
gaggaggagaaagagagaaagaagctggccagaacggccagtccagagaagcgccagaac
tctgagaaaccacccctagaggatgaaaagaaagaggaaaaaattgaactcaaatccatc
acttcagatggagagacgccaactgccaccaagatcaacatagatgagtacacaggggag
gacaacgaagagaaaaatccatatcctgtcaacgatttcccagcaggggaggatgacgag
gaggagccagagatgccagtaggtccccgtccacgtccactctctgacattcagctgaag
gagaaagccgtccccatgccacaagccaaagccttctttattttcagccccagtaacaag
ttcagggttttgtgtcataagattgtaaaccacaacatcttcaccaatttaatcctgttc
ttcatactgctgagcagtatttcactggcagcggaggacccagtgaagaatgactcattc
aggaatcagattctaggctatgcagattatgtgtttacaggaatcttcaccatagagatc
atattaaagatgacagcgtatggagcatttcttcataagggttcattttgtcggaattat
tttaatattttggatctggtggtggtcagtgtgtctctgatctcctctggaattcagtca
agtgccattaatgtagtgaagattctcagagtgctgagggtgttgaggcccctgagagca
atcaacagagccaagggcctcaaacatgtggttcagtgtgtgtttgttgccatccgcacc
atcgggaatatcgtcatcgtcacctctttgctgcagttcatgtttgcctgtattggtgtt
caactcttaaagggcaaattcttctactgcacagacacttctaaacagacgcaggctgag
tgcagaggggcctatatactgtacaaggatgggaatgttggagagccagagaaagctcaa
cgctcctgggagaacagtgacttcaactttgatgatgtcctacagggcatgatggctctg
tttgctgtgtccacttttgagggttggccagggctcctctacagagccatcgactcccat
gcagaggatgttgggccgatctacaactaccgtgtggtcatctccatattcttcatcatc
tacattatcatcatcgcattcttcatgatgaacatattcgtaggtttcgtcattgtgacg
tttcaggagcagggagagcaagagtacaaaaactgtgagctggacaagaaccagcgtcag
tgtgtggagtatgccctgaaagctcgtcccctacgcaggtacattcccaaaaacccatat
cagtacaaagtctggtacgtggtgaactctacctactttgagtacctgatgttcacgctc
atccttctcaacaccatctgcctggccatgcagcaccatggtcaatctcagtctttcaac
aaagccatgaatatcctcaatatgttgttcactggcctcttcactgtggaaatgatcctc
aaactcatcgctttcaaacccaggcattattttgttgatgcatggaacacgtttgatgcc
cttattgtagtgggtagtgttgttgatatagccatcacagaggttaacccagctgacccc
tcctcctctcccccctcctctgtggtaagaccaatgggcctccaaaacactgaggataac
gccaggatctcaatcacattctttcggctgttccgcgtgatgaggctggtgaagctcctg
tctcggggagagggtattcggacgttgctctggaccttcattaaatcctttcaggctctt
ccctatgttgcattgctgatcgtaatgctgttcttcatttatgccgtcattgggatgcag
atgtttggcaaaatcgccctgagggacaacagtcagatcaaccgaaacaacaactttcag
acatttcctcaggctgttctgcttctcttcaggtgtgcgacaggagaggcgtggcaggaa
atcatgctggcctgttctccaaaccgcccttgtgagaaggggtcagagatcaaccattcc
agcgaagactgtggcagtcactttgccatcttctactttgttagcttttatatgctttgc
gccttcctgatcattaacctttttgtggctgtcatcatggacaactttgactatttaaca
cgggattggtcgatactgggaccgcatcatctagatgagttcaaaagaatatgggcagaa
tatgatcctgaggctaagggtcggataaagcatctggatgtagtcacgttactgcgcaga
attcagccacctcttggatttggaaagctttgtccacatagagtggcatgcaagcgactt
gtgtccatgaacatgcctctcaatagtgatggaacggtgatgtttaatgcaactctcttt
gccctggtacgaacggctctacgcatcgaaaccgaaggtaacctggagcaggcgaatgag
gaacttagggccatcgtgaagaagatttggaagaggacaagcatgaagctgctggatcaa
gttgttccccctgctggagatgatgaagtcacagtggggaagttctatgctacattccta
attcaggaatacttcaggaaattcaagaagcgcaaggaacagggcctggtggccaaaata
cccccaaagactgctctttcactgcaggctggcctgcgaacactacatgatatgggtcca
gagatcagaagagcgatatcaggagacttgaccgtggaggaggagctggaaagggccatg
aaggaaactgtgtgtgctgcttctgaggatgatatcttcaggcggtctggtggcctcttc
ggtaaccatgtaaactactaccatcagagtgatggccacgtctccttcccacagtccttc
accacacagcggccattgcacatcagtaaatccgggagtcccggcgaggctgaatctccc
tctcatcagaagctggtggactccaccttcactcccagcagttactcttcctcaggatcc
aacgccaacatcaacaacgccaacaacaccgccatcggacaccgctatcccaaacctact
gtcagcacggtggacggacaaacagggcctcctctcaccaccatcccactgccacgaccc
acatggtgctttcctaacaagagctctgattccagtgacagtcgtctccctataatacgg
cgagaggaagcatctacagatgagacatatgatgaaacatttttagatgagagagatcag
gccatgctctccatggacatgctggaatttcaggatgaagaaagcaagcaactggctcct
atggtggaggcagaagtaggggaggagagaaggccgtggcagtctccacggcgacgggcc
ttcctctgccctactgcactgggtcgacggtcttcctttcacttggagtgtctgagaaag
cataacagacctgacgtttctcagaagacagcactaccattgcacctagtgcatcatcag
gctctggccgtggcagggttaagtcccttgctgagacggagtcactctccgacactgttc
acacgtctgtgttccacacctcctgcgagtcccagtggccgcagcggtggaggcccatgc
tatcagcctgtgccctctctgcggctggagggcagcggatcttacgagaagctcaacagc
agcatgccgtctgtgaactgcagctcatggtacagcgacagcaacggcaaccacagcggg
agggcgcagcgacccgtgtcccttacagttcctccggtcacgcgcagagactctatatcc
ctggcacacgggagcgccggcagcctcgtggaggcggtattgatatctgagggtttgggt
cgctatgcacatgatccctccttcatccaggtagcgaagcaggaaatagcggaggcctgt
gacatgacaatggaggagatggagaacgcggcagacaacattctcaacgctaacgcacca
cccaatgctaacggaaacctgcttcccttcatacagtgcagagacactggctcgcaggag
tcccgttgcagcctctcactgggcctttctcccgccacaggctctgatggggcactggag
gcggagctagaggagtcagagggggcggggcagcggaacagccctctgatggaggatgag
gacatggagtgcgtcacgagtttgtag

DBGET integrated database retrieval system