KEGG   Danio rerio (zebrafish): 246226Help
Entry
246226            CDS       T01004                                 

Gene name
ptgs1
Definition
(RefSeq) prostaglandin G/H synthase 1 precursor
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00590  Arachidonic acid metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    246226 (ptgs1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     246226 (ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 246226
NCBI-ProteinID: NP_705942
ZFIN: ZDB-GENE-020530-1
Ensembl: ENSDARG00000052148
Vega: OTTDARG00000018819
UniProt: Q8JH44
LinkDB All DBs
Position
5
AA seq 597 aa AA seqDB search
MRECNFLLKWTVILLLSVSFCAGEESPTSSNTANPCCYYPCQNQGICVRYGLERYECDCT
RTGYYGENCTIPELWTRVYRLLKPSPNVVHYILTHFDWLWDLINRSFLRDWLMRKVLTVR
ANLIPSPPTYNSRYDYLNWEAYSNITYYTRILPPVPNDCPTPMGTKGKIKLPDPKLLVEK
FMLRRNFRLDPQGTNLMFAFFAQHFTHQFFKTHNRVGLGFTKGLGHGVDAGHIYGDSLDR
QLELRLHKDGKLKYQVLNGDIYPPTVLHAQVKMSYPPSVPPEQQLAIGQEVFGLLPGLGM
YATLWLREHNRVCEILKQEHPTWGDEQLFQTARLIIIGETIRIVIEEYVQHLSGYRLKLH
FDPTLLFNSQFQYQNRISVEFNQLYHWHPLMPDSFYIDGDHIQYSKFIFNTSILTHYGLE
KLVEAFSIQPAGQIGGGHNIHPVVSGVAERVIVESRELRLQPFNEYRKRFNLKPYTSFAE
LTGEQEMSKELEELYGHIDAMEFYPALLLEKTRPGAVFGESMVEMGAPFSLKGLMGNPIC
SPDYWKPSTFGGKTGFDIVNSATLKKLVCLNTKWCPYVSFHTPPSDYKPQRTSHGEL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagagagtgtaactttttgctgaagtggacggtgattttgctgctgagtgtgtccttt
tgtgctggtgaagaaagcccgacttcatcaaacactgcgaatccttgttgctattaccct
tgtcaaaaccaagggatctgtgttcgatatggcctggaaagatatgaatgtgactgcacc
agaacgggctactatggagaaaattgcactatacctgagctctggacgcgggtctatcga
ctcctgaagcccagtccgaatgttgtccactacatcctcactcactttgactggttatgg
gacctcatcaacaggtcgttcctcagggattggctcatgcggaaagtgctcacagtaaga
gccaacttaatcccaagtcctccgacatacaattccagatatgattacttgaactgggag
gcttattccaacatcacctactacaccagaatcctaccgccggtccctaacgactgtcct
acaccaatgggaaccaaaggaaaaattaagcttccagaccctaaacttctggtagagaaa
ttcatgttaaggcggaacttcagactggaccctcagggaacgaatttgatgtttgcattt
ttcgctcagcacttcacacaccagtttttcaagactcacaaccgtgtggggctcgggttc
acaaaaggtctgggtcacggagtggatgctggacacatttatggagattctcttgatcgc
cagctggaactgcggttgcacaaagacgggaagctgaagtaccaggtgctcaacggtgat
atttaccccccgacggtgctgcatgcacaggtcaaaatgagttaccctccatcagtccct
ccagagcagcagttggccatcgggcaggaggtgttcgggctgctgccagggctcggcatg
tacgctaccttgtggcttcgtgagcacaaccgtgtgtgtgaaatcctgaaacaagaacat
ccaacctggggtgatgagcagctcttccagaccgccaggctcatcattataggtgagacc
attcgtatcgtaatcgaggagtatgtgcagcatctgagcggttaccggctgaagctgcat
tttgaccccacgctgctcttcaactcacagttccagtaccagaaccgcatttcagtggag
ttcaatcaactttaccactggcacccactcatgcctgacagcttctacatcgacggagac
cacattcagtactcaaagttcatatttaacacatcgatcctcacacattatggcttggag
aagctggtggaggccttctcaatacaacccgcaggacagatcggagggggtcataacatt
cacccagtggtgtccggagttgctgagagggtcatcgttgaatcgagggagcttcgactt
cagccgttcaatgaatatcgcaagagattcaatctgaaaccctacacatccttcgcagaa
ttgacaggagagcaggagatgtctaaagagctggaggaactatacggacatattgatgct
atggagttctacccagctcttctgctagagaaaacacgacctggtgcggtatttggtgaa
agcatggtggaaatgggggcccctttttccctaaaaggcctcatgggaaatcctatctgc
tccccagactactggaagcccagcacatttggaggcaagacaggcttcgatatagtaaac
tctgctactttaaagaaactggtgtgccttaatacgaaatggtgcccgtatgtgtctttc
cacactcccccatcagattataaaccacagaggacatctcacggcgaactttag

DBGET integrated database retrieval system