KEGG   Danio rerio (zebrafish): 30158Help
Entry
30158             CDS       T01004                                 

Gene name
lfng
Definition
(RefSeq) beta-1,3-N-acetylglucosaminyltransferase lunatic fringe precursor
  KO
K05948  fringe [EC:2.4.1.222]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
dre04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    30158 (lfng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    30158 (lfng)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    30158 (lfng)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     30158 (lfng)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  O-Glycan
   30158 (lfng)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 30158
NCBI-ProteinID: NP_571046
ZFIN: ZDB-GENE-980605-16
Ensembl: ENSDARG00000037879
Vega: OTTDARG00000020248
UniProt: Q8JHF2 B2GQK5
LinkDB All DBs
Position
3
AA seq 374 aa AA seqDB search
MLKTYRGKVVVSLAGATVTCLGFLLFLSQHQRIQADGMQNESEVGLRSLQSLGDSETDDG
AQPEQNAKKGFSAYFSKLTRSRREADKPSEAPGAATDAPPAEDISADDIFIAVKTTKKFH
RSRLDLLLDTWISRNMRQTYIFTDGEDEELKKKIGSHAINTNCSAAHSRQALSCKMAVEY
DKFIESGKKWFCHVDDDNYVNTKTLVKLLSNYPHTQDMYIGKPSLDRPIEATERLGDNKM
RPVNFWFATGGAGFCISRGLALKMSPWASGGHFMNTAEKIRLPDDCTIGYIIESVLGVSL
TRSSLFHSHLENLQQVSKSEVHKQITLSYGMFENKRNIINMKGAFSVEEDPSRFKSVHCL
LYPDTPWCPPQVAY
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaacatatcgcggaaaagtcgtggtctctcttgcgggagccaccgtcacctgt
ctggggtttctgttgtttctctcgcagcatcagcggattcaggcggacgggatgcagaac
gagagcgaggtcgggctgcgctcgctccagagtctgggagattcagagactgatgatgga
gctcagcctgagcagaatgcaaagaaaggattctctgcctatttttccaagctgacccgc
agcaggagggaagcggataagcccagcgaggcacccggagcggcgacagacgcgccgcct
gcggaggacatcagcgcggatgacatcttcatcgcagtgaagaccactaaaaagtttcac
cggtccagactggatctacttctggacacctggatctccagaaacatgcgacagacatac
atcttcacagatggcgaggatgaggagctgaagaagaaaattggaagccatgctatcaac
accaactgctctgctgcccacagtcgccaggctctgtcctgtaagatggctgttgaatat
gacaagttcattgagtctggaaaaaagtggttctgtcatgtggatgatgataactatgtg
aacacgaagacacttgtgaagttgctctccaactaccctcacactcaggacatgtacatt
ggcaaacctagcctggacaggccaattgaggctacagaaagacttggggacaacaaaatg
agacctgtgaatttctggtttgccactggaggagctggtttctgtatcagccgtgggctt
gctttgaagatgagtccatgggcaagtggtggccatttcatgaacactgctgagaagatc
cgtcttcctgatgactgcaccattggctatatcatcgagtcagttcttggggtctctttg
acccgaagcagcttgttccactcgcacttagagaacctgcaacaggtgtctaaatcagaa
gtacacaaacagattacattgagttacggaatgtttgaaaacaagaggaatatcatcaac
atgaaaggggctttctctgttgaggaggacccatccaggttcaagtcagtgcactgtctg
ctgtatccagacactccttggtgccctcctcaggttgcctactaa

KEGG   Danio rerio (zebrafish): 414848Help
Entry
414848            CDS       T01004                                 

Gene name
rfng
Definition
(RefSeq) beta-1,3-N-acetylglucosaminyltransferase radical fringe precursor
  KO
K05948  fringe [EC:2.4.1.222]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
dre04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    414848 (rfng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    414848 (rfng)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    414848 (rfng)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     414848 (rfng)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  O-Glycan
   414848 (rfng)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe
Motif
Other DBs
NCBI-GeneID: 414848
NCBI-ProteinID: NP_001001830
ZFIN: ZDB-GENE-030131-5418
Ensembl: ENSDARG00000019746
Vega: OTTDARG00000020473
UniProt: F1QXC7
LinkDB All DBs
Position
12
AA seq 362 aa AA seqDB search
MHLSHVGSNKTCFLLSLAFCALLVLLIPSLQPPQRQADLPQPRPHAKPAKHPLKNSLYRP
NEDTRGGSFTQTTPPENLQKMDDLNSHYRDFLDLRDIFIAVKTTRKYHKSRLQLLSQTWV
SRAKEQTFIFTDGEDKELRLKAGLNIINTNCSAAHTRQALCCKMSVEYDKFIESQKKWFC
HVDDDNYVILPSLLELLSSYSHTQDVYLGRPSLDHPIEAAERVKSDGSVSVKFWFATGGA
GFCISRGLALKMSPWASLGNFITTAEKIRLPDDCTIGYIIEALLEVPLTHTGLFHSHLEN
LQRLPAENILRQVTLSYGGFENRRNVVSVGGAFSLAEDPTRFKTVHCKLYPDTEWCPRKT
RH
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcacttatcccatgtcggctccaacaaaacctgctttctgctttccctcgcattctgt
gccctgctggtgctgcttattccctccttacaacctccacagcgtcaggcggatctgcct
cagccgcggccccatgccaaacccgccaaacacccactcaaaaactctctctacagacca
aatgaagacaccaggggtggtagttttactcaaacaactccacctgagaacctgcagaag
atggacgatctaaactcgcactacagagacttcctggacttaagagacatttttattgct
gtgaagaccactaggaagtatcacaagtccagattgcagctcctgtcccagacctgggtg
tccagagcgaaggagcagacgtttatcttcactgatggggaggacaaggagctccggctg
aaagcagggctgaacatcatcaacaccaactgctcggcggctcacacacgccaagccctg
tgctgcaagatgtctgtggagtatgacaagttcatcgagtcacagaaaaagtggttttgt
catgtggatgatgataactatgtgatcctgcccagtctactggagcttctgtcctcgtac
tctcacacacaggatgtgtatctgggccggcctagcctggatcatcctatagaggctgca
gagagagtcaagagcgacggatcggtgtcagtgaagttctggtttgccactggtggagct
ggtttctgcatcagtcgaggtttagcgctcaaaatgagtccatgggccagtcttggaaac
tttatcacaacagcagagaagatccgtctgccagatgactgtacaattggctacatcatc
gaggcgctgctggaggttcctctcacccacacaggcctgtttcactcacacctggagaac
ctgcagagactgcctgcagaaaacatcctgcgacaggtgaccctcagttatggtggattc
gagaacaggaggaatgtggtcagtgttggaggagcgttttcattggctgaagacccaaca
cggtttaaaacggttcactgcaagctctacccagacaccgagtggtgcccacgcaagact
cgccattga

KEGG   Danio rerio (zebrafish): 493633Help
Entry
493633            CDS       T01004                                 

Gene name
mfng
Definition
(RefSeq) beta-1,3-N-acetylglucosaminyltransferase manic fringe
  KO
K05948  fringe [EC:2.4.1.222]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00514  Other types of O-glycan biosynthesis
dre04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    493633 (mfng)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    493633 (mfng)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    493633 (mfng)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     493633 (mfng)
Glycosyltransferases [BR:dre01003]
 Glycan extension
  O-Glycan
   493633 (mfng)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T Adeno_E3A SIS
Motif
Other DBs
NCBI-GeneID: 493633
NCBI-ProteinID: NP_001007789
ZFIN: ZDB-GENE-041130-1
Ensembl: ENSDARG00000042925
Vega: OTTDARG00000029123
UniProt: Q5YB40 B2GP22
LinkDB All DBs
Position
22
AA seq 360 aa AA seqDB search
MILRRLFHVLPAFAFTLFILVLLDLQLRTRSDQKPQNAHDGHQRTTFISETTAENQHRDG
AHEKEKAEGQKWTEVRSTPPLELSDIFIAVKTTGRFHKSRLALLLETWISETKEHTYIFT
DSPDADISSEGFNVVVTNCSPEHSHQALSCKMAAEYDYFMASYKKWLCHVDDDNYLNPGA
LLSLLMAFPADGDIYVGKPSLDRPMRAQELLEGNKTRDVHFWFATGGAGFCLSRNLAERM
APWASGPRFEQTSAVIMLPDDCTVGFIVERRLGISMIHSNMFHSHLENLLLLSPSDIPKQ
VTLSYGWFESKMNSVELKGVFTKDEDPSRFRTVHCLLYPTTSWCPVALKSALSWNQHVMH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaggaggctgtttcatgtactgcctgctttcgcttttacgctttttattttg
gttttgctggatctgcagctgcgcaccaggagtgaccaaaagccccaaaacgcgcacgat
gggcaccaacggacaacttttatatcagaaaccacggctgaaaaccaacacagagatggt
gctcatgagaaagaaaaagcagaaggtcagaaatggacggaggtgaggtctacaccacct
ttagagctcagtgacatcttcattgcggtgaaaaccaccggccgcttccacaagagccgc
cttgctcttcttctggagacctggatctctgagactaaagagcacacgtacatctttaca
gatagtccagacgcagacatttcttcagaaggttttaacgttgtcgtcactaattgttca
cctgagcacagtcatcaagcattatcctgcaagatggctgctgagtatgactacttcatg
gcctcctacaaaaagtggctgtgtcatgttgatgatgataactatctgaatcccggagct
cttctctctctcctgatggcctttccagcagatggcgatatttatgtaggaaaacctagt
ctggatcgaccaatgagagcgcaggagctgctggagggaaacaagacgagggatgtccat
ttctggtttgctacaggaggggctggtttctgcctgagcaggaacctggcagaaaggatg
gcaccctgggcaagtggtcccaggtttgaacaaacatctgctgtgataatgttgcctgat
gactgtaccgtgggttttatagttgagaggcgactgggcatctcgatgatccatagcaat
atgtttcactctcatttagaaaacctactccttctgtcccccagcgatattccaaaacag
gtgactctaagctacggatggtttgagagtaaaatgaacagtgttgaattaaaaggagtt
tttaccaaagatgaagatccgtccaggttcaggacagttcactgtcttctataccctaca
acaagttggtgcccagttgccctcaaaagtgccttgtcatggaatcaacatgtgatgcac
tga

DBGET integrated database retrieval system