KEGG   Danio rerio (zebrafish): 30222
Entry
30222             CDS       T01004                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04068  FoxO signaling pathway
dre04110  Cell cycle
dre04115  p53 signaling pathway
dre04218  Cellular senescence
dre04310  Wnt signaling pathway
dre04340  Hedgehog signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04530  Tight junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    30222 (ccnd1)
   04340 Hedgehog signaling pathway
    30222 (ccnd1)
   04371 Apelin signaling pathway
    30222 (ccnd1)
   04068 FoxO signaling pathway
    30222 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    30222 (ccnd1)
   04115 p53 signaling pathway
    30222 (ccnd1)
   04218 Cellular senescence
    30222 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    30222 (ccnd1)
   04530 Tight junction
    30222 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C zf-C2H2_2
Other DBs
NCBI-GeneID: 30222
NCBI-ProteinID: NP_571100
ZFIN: ZDB-GENE-980526-176
Ensembl: ENSDARG00000101637
Vega: OTTDARG00000016625
UniProt: Q90459 A7YYE4
LinkDB
Position
7
AA seq 291 aa
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPGELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSTDSCLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHISTETKRVEEDVDLSCTPTDVRDINI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggagcaccagttgttttgctgcgaagtggataccataagaagagcttaccaagacagc
aacctgttgaatgaccgagttttacagacaatgcttaaagctgaggaaaactatctccca
tcaccaaattatttcaagtgtgttcagaaagaaattgtgcctaaaatgaggaaaatcgtc
gcgacgtggatgctcgaggtctgtgaagagcagaaatgtgaagaggaagtttttcctttg
gctatgaactacctggacaggtttttatctgtggagcccaccaaaaaaaccaggttgcag
cttttaggagcaacttgtatgtttctggcttcaaaaatgaaagagactgtgccacttaca
gcagagaagttgtgcatatacacggacaactctgtccgtcccggcgaattattgcaaatg
gaactgctggcgctaaataaactgaagtgggatctggcctcagtgacaccacatgatttc
attgaacacttccttgccaaactgcctatacatcagagctccaagcagatactgcgcaaa
cacgcccagacctttgtggccctctgtgcgacagacgtcaacttcatcgcaagccctccc
tccatgattgcagcaggcagtgttgctgcagcggtacaaggactgtacctgaaaagcacc
gacagttgcctctcatcccagaacctcaccaacttcctctcgcaagtcatcagaagtgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatcgagtctcaga
caagctcagcagcacatctccacagagaccaaaagggtcgaggaggacgtggacctctct
tgcactcccacagacgtcagagacattaacatttga

DBGET integrated database retrieval system