KEGG   Danio rerio (zebrafish): 30380
Entry
30380             CDS       T01004                                 

Gene name
nras
Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    30380 (nras)
   04012 ErbB signaling pathway
    30380 (nras)
   04370 VEGF signaling pathway
    30380 (nras)
   04371 Apelin signaling pathway
    30380 (nras)
   04068 FoxO signaling pathway
    30380 (nras)
   04150 mTOR signaling pathway
    30380 (nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    30380 (nras)
   04137 Mitophagy - animal
    30380 (nras)
  09143 Cell growth and death
   04210 Apoptosis
    30380 (nras)
   04218 Cellular senescence
    30380 (nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    30380 (nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    30380 (nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    30380 (nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    30380 (nras)
   04912 GnRH signaling pathway
    30380 (nras)
   04916 Melanogenesis
    30380 (nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    30380 (nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    30380 (nras)
   04031 GTP-binding proteins [BR:dre04031]
    30380 (nras)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    30380 (nras)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   30380 (nras)
  Exosomal proteins of other body fluids (saliva and urine)
   30380 (nras)
  Exosomal proteins of breast cancer cells
   30380 (nras)
  Exosomal proteins of colorectal cancer cells
   30380 (nras)
GTP-binding proteins [BR:dre04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    30380 (nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin VirE Ldh_1_N
Other DBs
NCBI-GeneID: 30380
NCBI-ProteinID: NP_571220
ZFIN: ZDB-GENE-990415-166
Ensembl: ENSDARG00000038225
Vega: OTTDARG00000028753
UniProt: Q6DGD1
LinkDB
Position
8
AA seq 188 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL
ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC
LGVSCEVM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgagtataagctggttgttgtgggagcaggaggtgttgggaagagcgcgttaaca
atccagctcatccagaatcactttgtggatgaatatgaccccactattgaggactcttac
aggaagcaggtggtgattgacggcgagacgtgtctgctggacatcctggacactgcaggc
caggaagagtacagcgcaatgagagaccagtacatgaggacaggagagggtttcctctgc
gtcttcgctatcaacaacagcaaatccttcgccgacgtgcatttgtacagagagcagatc
aagcgtgtgaaggactcggatgatgttcccatggtcctagtggggaacaaatgtgatttg
gcaaggactgtggacaccaagcaagctcaggaacttgccagaagctacggcattgagttt
gtagaaacctctgccaaaaccagacagggagtcgaggatgctttctacacccttgtccgt
gagatccggcattatcgcatgaaaaagctcaacagcagagaagacaggaagcagggctgt
ctgggcgtgtcctgtgaagtcatgtga

KEGG   Danio rerio (zebrafish): 393228
Entry
393228            CDS       T01004                                 

Definition
(RefSeq) zgc:55558
  KO
K07827  GTPase KRas
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    393228
   04012 ErbB signaling pathway
    393228
   04370 VEGF signaling pathway
    393228
   04371 Apelin signaling pathway
    393228
   04068 FoxO signaling pathway
    393228
   04150 mTOR signaling pathway
    393228
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    393228
   04137 Mitophagy - animal
    393228
  09143 Cell growth and death
   04210 Apoptosis
    393228
   04218 Cellular senescence
    393228
  09144 Cellular community - eukaryotes
   04540 Gap junction
    393228
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    393228
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    393228
  09152 Endocrine system
   04910 Insulin signaling pathway
    393228
   04912 GnRH signaling pathway
    393228
   04914 Progesterone-mediated oocyte maturation
    393228
   04916 Melanogenesis
    393228
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    393228
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dre04031]
    393228
Membrane trafficking [BR:dre04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    393228
GTP-binding proteins [BR:dre04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    393228
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N G-alpha ATP_bind_1 AAA_14 Septin AAA_25
Other DBs
NCBI-GeneID: 393228
NCBI-ProteinID: NP_956552
ZFIN: ZDB-GENE-040426-740
Ensembl: ENSDARG00000013161
Vega: OTTDARG00000019272
UniProt: Q7ZUL8
LinkDB
Position
3
AA seq 187 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDVHLYREQINRVKDSDNVPMVLVGNKSDL
TSRTVDTRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKHT
QRRCTLL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgacagaatacaagctggtcgttgtcggtgcgggtggtgttgggaaaagtgcactgacc
atccagctcattcagaatcacttcgtagatgagtacgatcccacaattgaggattcatac
agaaagcaggttgtgattgatggagagacgtgtttgctggatatcctggacactgcaggt
caggaggagtacagtgccatgagagaccagtatatgaggacaggagagggatttctttgt
gtgtttgccatcaacaatgccaagtcctttgaggacgtacatctttacagggagcaaata
aaccgtgtcaaagacagcgataatgtcccgatggtgctggtggggaacaaaagtgacctg
acgtctcgtactgtagacacgcgtcaagcccaagaactggccagaagttacggggtccca
tttgttgaaacatcagccaagacgcgtcagggagtggaggaggccttttactctctcgtg
agggagatccgaagatataaggagaccaaccgcagcaataagaagagcaaaaagcacaca
cagagacgttgcactcttttatag

KEGG   Danio rerio (zebrafish): 445289
Entry
445289            CDS       T01004                                 

Gene name
kras
Definition
(RefSeq) GTPase KRas isoform 2
  KO
K07827  GTPase KRas
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    445289 (kras)
   04012 ErbB signaling pathway
    445289 (kras)
   04370 VEGF signaling pathway
    445289 (kras)
   04371 Apelin signaling pathway
    445289 (kras)
   04068 FoxO signaling pathway
    445289 (kras)
   04150 mTOR signaling pathway
    445289 (kras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    445289 (kras)
   04137 Mitophagy - animal
    445289 (kras)
  09143 Cell growth and death
   04210 Apoptosis
    445289 (kras)
   04218 Cellular senescence
    445289 (kras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    445289 (kras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    445289 (kras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    445289 (kras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    445289 (kras)
   04912 GnRH signaling pathway
    445289 (kras)
   04914 Progesterone-mediated oocyte maturation
    445289 (kras)
   04916 Melanogenesis
    445289 (kras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    445289 (kras)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dre04031]
    445289 (kras)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    445289 (kras)
GTP-binding proteins [BR:dre04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    445289 (kras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N MeaB ATP_bind_1 Septin CbiA ParA AAA_25 NPR1_interact
Other DBs
NCBI-GeneID: 445289
NCBI-ProteinID: NP_001003744
ZFIN: ZDB-GENE-040808-67
Ensembl: ENSDARG00000010844
UniProt: Q6AZA4
LinkDB
Position
25
AA seq 188 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
QSHNVDSKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKEGKKKKKK
SKTKCALM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaccgaatataagcttgtggtcgtgggagctggaggcgtaggcaaaagcgctctcacc
atccaactcatccagaaccactttgtggacgaatatgacccaactatagaggactcgtac
aggaagcaggtggtgattgacggagagacgtgtctactggacatcctggacactgcaggt
caggaggagtacagtgccatgagggaccagtacatgaggacaggagagggcttcctctgt
gtctttgccatcaataacaccaagtccttcgaggacattcaccactacagggagcagata
aagcgagtaaaggactccgaggacgtccccatggttctggtggggaataagtgtgatctt
cagtcccacaatgtggactccaagcaggctcaggatttagcacgcagctacggcatccca
tttatagagacctcagcaaagacaagacagggtgtggacgacgcgttttatactttagtc
cgagaaatccggaaacacaaggagaagatgagcaaggagggcaaaaagaaaaagaagaaa
tccaaaacaaaatgtgcattaatgtga

KEGG   Danio rerio (zebrafish): 550286
Entry
550286            CDS       T01004                                 

Gene name
hrasa
Definition
(RefSeq) HRas proto-oncogene, GTPase a
  KO
K02833  GTPase HRas
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04144  Endocytosis
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    550286 (hrasa)
   04012 ErbB signaling pathway
    550286 (hrasa)
   04370 VEGF signaling pathway
    550286 (hrasa)
   04371 Apelin signaling pathway
    550286 (hrasa)
   04068 FoxO signaling pathway
    550286 (hrasa)
   04150 mTOR signaling pathway
    550286 (hrasa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    550286 (hrasa)
   04140 Autophagy - animal
    550286 (hrasa)
   04137 Mitophagy - animal
    550286 (hrasa)
  09143 Cell growth and death
   04210 Apoptosis
    550286 (hrasa)
   04218 Cellular senescence
    550286 (hrasa)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    550286 (hrasa)
   04540 Gap junction
    550286 (hrasa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    550286 (hrasa)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    550286 (hrasa)
  09152 Endocrine system
   04910 Insulin signaling pathway
    550286 (hrasa)
   04912 GnRH signaling pathway
    550286 (hrasa)
   04916 Melanogenesis
    550286 (hrasa)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    550286 (hrasa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    550286 (hrasa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    550286 (hrasa)
   04031 GTP-binding proteins [BR:dre04031]
    550286 (hrasa)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    550286 (hrasa)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   550286 (hrasa)
  Exosomal proteins of colorectal cancer cells
   550286 (hrasa)
GTP-binding proteins [BR:dre04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    550286 (hrasa)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin ParA CbiA AAA_25
Other DBs
NCBI-GeneID: 550286
NCBI-ProteinID: NP_001017623
ZFIN: ZDB-GENE-050417-95
Ensembl: ENSDARG00000098497
Vega: OTTDARG00000036499
UniProt: Q568K0
LinkDB
Position
25
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARIVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggaatataaactggtggtggtgggtgcaggaggcgtgggtaaaagtgctctcacc
atccaacttatccagaaccactttgtggatgaatacgatcctactatagaggactcctac
agaaagcaggtggtgattgatggggagacgtgtctattggacatcttggacactgcaggt
caggaggagtacagcgccatgagggaccagtacatgagaacaggcgagggcttcctctgt
gtgtttgccatcaataacaccaagtcctttgaggacattcatcaatacagagaacagatc
aaacgggtaaaagactctgatgatgtgcccatggtgcttgtgggtaacaaatgtgacctc
ccggctcggattgtggacacacggcaagcacaagaactcgcccgcagttacggaatccct
ttcattgaaacctcagccaaaaccaggcaaggtgtggaagatgcattttacacgctcgta
cgagagattcgtcaacacaaaatgaggaagctgaatccaccagacgagagtggccaggac
tgcatgagctgccgatgtgttgtgtcgtga

KEGG   Danio rerio (zebrafish): 553656
Entry
553656            CDS       T01004                                 

Gene name
hrasb
Definition
(RefSeq) HRas proto-oncogene, GTPase b
  KO
K02833  GTPase HRas
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04144  Endocytosis
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04218  Cellular senescence
dre04370  VEGF signaling pathway
dre04371  Apelin signaling pathway
dre04510  Focal adhesion
dre04540  Gap junction
dre04625  C-type lectin receptor signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04916  Melanogenesis
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    553656 (hrasb)
   04012 ErbB signaling pathway
    553656 (hrasb)
   04370 VEGF signaling pathway
    553656 (hrasb)
   04371 Apelin signaling pathway
    553656 (hrasb)
   04068 FoxO signaling pathway
    553656 (hrasb)
   04150 mTOR signaling pathway
    553656 (hrasb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    553656 (hrasb)
   04140 Autophagy - animal
    553656 (hrasb)
   04137 Mitophagy - animal
    553656 (hrasb)
  09143 Cell growth and death
   04210 Apoptosis
    553656 (hrasb)
   04218 Cellular senescence
    553656 (hrasb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    553656 (hrasb)
   04540 Gap junction
    553656 (hrasb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    553656 (hrasb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    553656 (hrasb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    553656 (hrasb)
   04912 GnRH signaling pathway
    553656 (hrasb)
   04916 Melanogenesis
    553656 (hrasb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    553656 (hrasb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    553656 (hrasb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    553656 (hrasb)
   04031 GTP-binding proteins [BR:dre04031]
    553656 (hrasb)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    553656 (hrasb)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   553656 (hrasb)
  Exosomal proteins of colorectal cancer cells
   553656 (hrasb)
GTP-binding proteins [BR:dre04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    553656 (hrasb)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin ATP_bind_1 AAA_25
Other DBs
NCBI-GeneID: 553656
NCBI-ProteinID: NP_001018465
ZFIN: ZDB-GENE-050522-466
Ensembl: ENSDARG00000005651
Vega: OTTDARG00000022165
UniProt: Q503B6
LinkDB
Position
7
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQD
CMNCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagttggtggttgtaggtgcaggtggtgtgggcaagagtgctctgacc
attcagctcatccagaaccacttcgttgatgagtatgacccaaccattgaggattcatat
aggaaacaagtggtgatcgatggagagacctgtttgttggatatcctggatactgcaggt
caagaagagtacagtgcaatgagagaccagtacatgaggactggagagggctttctctgt
gtttttgccatcaacaataccaaatcttttgaggacatccatcaatacagggaacaaatt
aagagggttaaagactcagatgatgtgcctatggtgcttgtgggtaataaatgtgatcta
ccagcgcgcactgtggatacaagacaagcccaggaactggcccgtagttatgggatacct
tacattgagacctcagccaagacacgacagggagtggaagatgccttttacacacttgtt
cgtgaaatcaggcagcataagttgaggaaactgaacccacctgatgacaatggccaagac
tgtatgaactgccgctgtgtcgtgtcatga

DBGET integrated database retrieval system